Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 1696707..1697314 | Replicon | chromosome |
Accession | NZ_CP104408 | ||
Organism | Pseudomonas fluorescens strain Ant01 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | N4P55_RS07740 | Protein ID | WP_262667977.1 |
Coordinates | 1696707..1696982 (+) | Length | 92 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A172YY36 |
Locus tag | N4P55_RS07745 | Protein ID | WP_064451284.1 |
Coordinates | 1697021..1697314 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4P55_RS07710 (N4P55_07725) | 1691976..1692308 | - | 333 | WP_262667268.1 | hypothetical protein | - |
N4P55_RS07715 (N4P55_07730) | 1692394..1692804 | - | 411 | WP_064451279.1 | type II toxin-antitoxin system HicB family antitoxin | - |
N4P55_RS07720 (N4P55_07735) | 1692827..1693009 | - | 183 | WP_262667269.1 | type II toxin-antitoxin system HicA family toxin | - |
N4P55_RS07725 (N4P55_07740) | 1693175..1694068 | - | 894 | WP_262667270.1 | LysR family transcriptional regulator | - |
N4P55_RS07730 (N4P55_07745) | 1694164..1695327 | + | 1164 | WP_262667271.1 | MFS transporter | - |
N4P55_RS07735 (N4P55_07750) | 1695324..1696460 | + | 1137 | WP_262667272.1 | MFS transporter | - |
N4P55_RS07740 (N4P55_07755) | 1696707..1696982 | + | 276 | WP_262667977.1 | hypothetical protein | Toxin |
N4P55_RS07745 (N4P55_07760) | 1697021..1697314 | + | 294 | WP_064451284.1 | helix-turn-helix domain-containing protein | Antitoxin |
N4P55_RS07750 (N4P55_07765) | 1697334..1697537 | - | 204 | WP_262667273.1 | hypothetical protein | - |
N4P55_RS07755 (N4P55_07770) | 1697970..1698209 | + | 240 | WP_064451286.1 | DUF6124 family protein | - |
N4P55_RS07760 (N4P55_07775) | 1698291..1698596 | - | 306 | WP_221294183.1 | DUF6482 family protein | - |
N4P55_RS07765 (N4P55_07780) | 1698620..1699144 | - | 525 | WP_064451288.1 | DUF3833 domain-containing protein | - |
N4P55_RS07775 (N4P55_07790) | 1699629..1700513 | - | 885 | WP_262667274.1 | alpha/beta hydrolase | - |
N4P55_RS07780 (N4P55_07795) | 1700818..1701510 | - | 693 | WP_262667275.1 | pseudouridine synthase | - |
N4P55_RS07785 (N4P55_07800) | 1701510..1701722 | - | 213 | WP_064451291.1 | cysteine-rich CWC family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10290.88 Da Isoelectric Point: 6.9757
>T257920 WP_262667977.1 NZ_CP104408:1696707-1696982 [Pseudomonas fluorescens]
VIFVESPVFTEDLPALLSEESYGEFQEFLAENPTAGDVIQGTNGLRKIRWAVQGRGKRGGVRVIYYHLCMAYQIRLILIY
RKGIKDDLSAV
VIFVESPVFTEDLPALLSEESYGEFQEFLAENPTAGDVIQGTNGLRKIRWAVQGRGKRGGVRVIYYHLCMAYQIRLILIY
RKGIKDDLSAV
Download Length: 276 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|