Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 3636967..3637642 | Replicon | chromosome |
Accession | NZ_CP104405 | ||
Organism | Enterobacter hormaechei subsp. steigerwaltii strain 4236 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A837FDC1 |
Locus tag | N5F16_RS17470 | Protein ID | WP_015571638.1 |
Coordinates | 3636967..3637266 (+) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A2J0PXC9 |
Locus tag | N5F16_RS17475 | Protein ID | WP_015571639.1 |
Coordinates | 3637277..3637642 (+) | Length | 122 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5F16_RS17460 (N5F16_17460) | 3633344..3635536 | + | 2193 | WP_017692801.1 | type I secretion system permease/ATPase | - |
N5F16_RS17465 (N5F16_17465) | 3635517..3636716 | + | 1200 | WP_017382757.1 | HlyD family efflux transporter periplasmic adaptor subunit | - |
N5F16_RS17470 (N5F16_17470) | 3636967..3637266 | + | 300 | WP_015571638.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N5F16_RS17475 (N5F16_17475) | 3637277..3637642 | + | 366 | WP_015571639.1 | HigA family addiction module antitoxin | Antitoxin |
N5F16_RS17480 (N5F16_17480) | 3637669..3638850 | - | 1182 | WP_017382758.1 | PLP-dependent aminotransferase family protein | - |
N5F16_RS17485 (N5F16_17485) | 3638871..3639758 | - | 888 | WP_015571641.1 | LysR family transcriptional regulator | - |
N5F16_RS17490 (N5F16_17490) | 3639856..3640458 | + | 603 | WP_017382759.1 | short chain dehydrogenase | - |
N5F16_RS17495 (N5F16_17495) | 3640455..3641186 | - | 732 | WP_039269965.1 | class I SAM-dependent methyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11624.29 Da Isoelectric Point: 9.6776
>T257914 WP_015571638.1 NZ_CP104405:3636967-3637266 [Enterobacter hormaechei subsp. steigerwaltii]
MINHFRDQWLEDFFLYGRSSNVIPLNLETALARKLDIINAAMSHLDLRSPPGNMYEALSPPLKGYSSIRVNRQYRLVFRW
SEGKADDLYLSPHKYTQHK
MINHFRDQWLEDFFLYGRSSNVIPLNLETALARKLDIINAAMSHLDLRSPPGNMYEALSPPLKGYSSIRVNRQYRLVFRW
SEGKADDLYLSPHKYTQHK
Download Length: 300 bp
Antitoxin
Download Length: 122 a.a. Molecular weight: 13705.73 Da Isoelectric Point: 9.5936
>AT257914 WP_015571639.1 NZ_CP104405:3637277-3637642 [Enterobacter hormaechei subsp. steigerwaltii]
MTLQQALRKPTTPGEVLQYEYLEPLNLKINDLAEMLNVHRNTVSALVNNNRKLTADMAIKLAKAFNTTIEFWLNLQLNVD
IWEAQSNSRTQEELSRIKTVAEVMAKRKSGKPDVTLHGNSA
MTLQQALRKPTTPGEVLQYEYLEPLNLKINDLAEMLNVHRNTVSALVNNNRKLTADMAIKLAKAFNTTIEFWLNLQLNVD
IWEAQSNSRTQEELSRIKTVAEVMAKRKSGKPDVTLHGNSA
Download Length: 366 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A837FDC1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2J0PXC9 |