Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 3664500..3665175 | Replicon | chromosome |
Accession | NZ_CP104401 | ||
Organism | Enterobacter hormaechei subsp. steigerwaltii strain colR |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A837FDC1 |
Locus tag | N5F15_RS17655 | Protein ID | WP_015571638.1 |
Coordinates | 3664500..3664799 (+) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A2J0PXC9 |
Locus tag | N5F15_RS17660 | Protein ID | WP_015571639.1 |
Coordinates | 3664810..3665175 (+) | Length | 122 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5F15_RS17645 (N5F15_17645) | 3660877..3663069 | + | 2193 | WP_017692801.1 | type I secretion system permease/ATPase | - |
N5F15_RS17650 (N5F15_17650) | 3663050..3664249 | + | 1200 | WP_017382757.1 | HlyD family efflux transporter periplasmic adaptor subunit | - |
N5F15_RS17655 (N5F15_17655) | 3664500..3664799 | + | 300 | WP_015571638.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N5F15_RS17660 (N5F15_17660) | 3664810..3665175 | + | 366 | WP_015571639.1 | HigA family addiction module antitoxin | Antitoxin |
N5F15_RS17665 (N5F15_17665) | 3665202..3666383 | - | 1182 | WP_017382758.1 | PLP-dependent aminotransferase family protein | - |
N5F15_RS17670 (N5F15_17670) | 3666404..3667291 | - | 888 | WP_015571641.1 | LysR family transcriptional regulator | - |
N5F15_RS17675 (N5F15_17675) | 3667389..3667991 | + | 603 | WP_017382759.1 | short chain dehydrogenase | - |
N5F15_RS17680 (N5F15_17680) | 3667988..3668719 | - | 732 | WP_039269965.1 | class I SAM-dependent methyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 3660877..3686130 | 25253 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11624.29 Da Isoelectric Point: 9.6776
>T257877 WP_015571638.1 NZ_CP104401:3664500-3664799 [Enterobacter hormaechei subsp. steigerwaltii]
MINHFRDQWLEDFFLYGRSSNVIPLNLETALARKLDIINAAMSHLDLRSPPGNMYEALSPPLKGYSSIRVNRQYRLVFRW
SEGKADDLYLSPHKYTQHK
MINHFRDQWLEDFFLYGRSSNVIPLNLETALARKLDIINAAMSHLDLRSPPGNMYEALSPPLKGYSSIRVNRQYRLVFRW
SEGKADDLYLSPHKYTQHK
Download Length: 300 bp
Antitoxin
Download Length: 122 a.a. Molecular weight: 13705.73 Da Isoelectric Point: 9.5936
>AT257877 WP_015571639.1 NZ_CP104401:3664810-3665175 [Enterobacter hormaechei subsp. steigerwaltii]
MTLQQALRKPTTPGEVLQYEYLEPLNLKINDLAEMLNVHRNTVSALVNNNRKLTADMAIKLAKAFNTTIEFWLNLQLNVD
IWEAQSNSRTQEELSRIKTVAEVMAKRKSGKPDVTLHGNSA
MTLQQALRKPTTPGEVLQYEYLEPLNLKINDLAEMLNVHRNTVSALVNNNRKLTADMAIKLAKAFNTTIEFWLNLQLNVD
IWEAQSNSRTQEELSRIKTVAEVMAKRKSGKPDVTLHGNSA
Download Length: 366 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A837FDC1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2J0PXC9 |