Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 3762393..3763087 Replicon chromosome
Accession NZ_CP104384
Organism Escherichia coli strain JNQH498

Toxin (Protein)


Gene name yafO Uniprot ID Q47157
Locus tag KIG00_RS18520 Protein ID WP_001263489.1
Coordinates 3762393..3762791 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID S1QAE3
Locus tag KIG00_RS18525 Protein ID WP_000554758.1
Coordinates 3762794..3763087 (-) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
- (3757981) 3757981..3758061 - 81 NuclAT_12 - -
- (3757981) 3757981..3758061 - 81 NuclAT_12 - -
- (3757981) 3757981..3758061 - 81 NuclAT_12 - -
- (3757981) 3757981..3758061 - 81 NuclAT_12 - -
KIG00_RS18495 (3758657) 3758657..3759115 - 459 WP_001291990.1 xanthine phosphoribosyltransferase -
KIG00_RS18500 (3759376) 3759376..3760833 + 1458 WP_001292994.1 cytosol nonspecific dipeptidase -
KIG00_RS18505 (3760890) 3760890..3761411 - 522 Protein_3622 peptide chain release factor H -
KIG00_RS18510 (3761407) 3761407..3761613 - 207 Protein_3623 RtcB family protein -
KIG00_RS18515 (3761931) 3761931..3762383 - 453 WP_001059892.1 GNAT family N-acetyltransferase -
KIG00_RS18520 (3762393) 3762393..3762791 - 399 WP_001263489.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
KIG00_RS18525 (3762794) 3762794..3763087 - 294 WP_000554758.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
KIG00_RS18530 (3763139) 3763139..3764194 - 1056 WP_001226164.1 DNA polymerase IV -
KIG00_RS18535 (3764265) 3764265..3765188 - 924 WP_001232546.1 putative lateral flagellar export/assembly protein LafU -
KIG00_RS18540 (3765191) 3765191..3766054 - 864 WP_001169518.1 flagellar motor stator protein MotA -
KIG00_RS18545 (3766067) 3766067..3766783 - 717 WP_000938723.1 FliA/WhiG family RNA polymerase sigma factor -
KIG00_RS18550 (3766803) 3766803..3767270 - 468 WP_000725257.1 flagellar basal body-associated FliL family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15487.84 Da        Isoelectric Point: 7.4215

>T257847 WP_001263489.1 NZ_CP104384:c3762791-3762393 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11233.76 Da        Isoelectric Point: 5.2170

>AT257847 WP_000554758.1 NZ_CP104384:c3763087-3762794 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKPIKARFRPSAARLEEITRRA
EQYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A090J8B1

Antitoxin

Source ID Structure
AlphaFold DB S1QAE3

References