Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 3762393..3763087 | Replicon | chromosome |
| Accession | NZ_CP104384 | ||
| Organism | Escherichia coli strain JNQH498 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | Q47157 |
| Locus tag | KIG00_RS18520 | Protein ID | WP_001263489.1 |
| Coordinates | 3762393..3762791 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | S1QAE3 |
| Locus tag | KIG00_RS18525 | Protein ID | WP_000554758.1 |
| Coordinates | 3762794..3763087 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| - (3757981) | 3757981..3758061 | - | 81 | NuclAT_12 | - | - |
| - (3757981) | 3757981..3758061 | - | 81 | NuclAT_12 | - | - |
| - (3757981) | 3757981..3758061 | - | 81 | NuclAT_12 | - | - |
| - (3757981) | 3757981..3758061 | - | 81 | NuclAT_12 | - | - |
| KIG00_RS18495 (3758657) | 3758657..3759115 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
| KIG00_RS18500 (3759376) | 3759376..3760833 | + | 1458 | WP_001292994.1 | cytosol nonspecific dipeptidase | - |
| KIG00_RS18505 (3760890) | 3760890..3761411 | - | 522 | Protein_3622 | peptide chain release factor H | - |
| KIG00_RS18510 (3761407) | 3761407..3761613 | - | 207 | Protein_3623 | RtcB family protein | - |
| KIG00_RS18515 (3761931) | 3761931..3762383 | - | 453 | WP_001059892.1 | GNAT family N-acetyltransferase | - |
| KIG00_RS18520 (3762393) | 3762393..3762791 | - | 399 | WP_001263489.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| KIG00_RS18525 (3762794) | 3762794..3763087 | - | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| KIG00_RS18530 (3763139) | 3763139..3764194 | - | 1056 | WP_001226164.1 | DNA polymerase IV | - |
| KIG00_RS18535 (3764265) | 3764265..3765188 | - | 924 | WP_001232546.1 | putative lateral flagellar export/assembly protein LafU | - |
| KIG00_RS18540 (3765191) | 3765191..3766054 | - | 864 | WP_001169518.1 | flagellar motor stator protein MotA | - |
| KIG00_RS18545 (3766067) | 3766067..3766783 | - | 717 | WP_000938723.1 | FliA/WhiG family RNA polymerase sigma factor | - |
| KIG00_RS18550 (3766803) | 3766803..3767270 | - | 468 | WP_000725257.1 | flagellar basal body-associated FliL family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15487.84 Da Isoelectric Point: 7.4215
>T257847 WP_001263489.1 NZ_CP104384:c3762791-3762393 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A090J8B1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1QAE3 |