Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/Tad-HTH_37 |
| Location | 3977942..3978539 | Replicon | chromosome |
| Accession | NZ_CP104373 | ||
| Organism | Klebsiella pneumoniae strain 2021CK-01815 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | R4YIC5 |
| Locus tag | N4558_RS19170 | Protein ID | WP_004142563.1 |
| Coordinates | 3978222..3978539 (-) | Length | 106 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | R4YH91 |
| Locus tag | N4558_RS19165 | Protein ID | WP_004142561.1 |
| Coordinates | 3977942..3978229 (-) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4558_RS19135 (N4558_19130) | 3974022..3974270 | + | 249 | WP_002893037.1 | DUF1158 domain-containing protein | - |
| N4558_RS19140 (N4558_19135) | 3974288..3974629 | - | 342 | WP_002893035.1 | RamA family antibiotic efflux transcriptional regulator | - |
| N4558_RS19145 (N4558_19140) | 3974660..3975775 | - | 1116 | WP_012737592.1 | MBL fold metallo-hydrolase | - |
| N4558_RS19150 (N4558_19145) | 3975955..3976536 | + | 582 | WP_004176968.1 | TetR/AcrR family transcriptional regulator | - |
| N4558_RS19155 (N4558_19150) | 3976536..3976904 | + | 369 | WP_004142557.1 | MmcQ/YjbR family DNA-binding protein | - |
| N4558_RS19160 (N4558_19155) | 3977024..3977677 | + | 654 | WP_019704893.1 | oxygen-insensitive NAD(P)H nitroreductase | - |
| N4558_RS19165 (N4558_19160) | 3977942..3978229 | - | 288 | WP_004142561.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| N4558_RS19170 (N4558_19165) | 3978222..3978539 | - | 318 | WP_004142563.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| N4558_RS19175 (N4558_19170) | 3978724..3979767 | - | 1044 | WP_019704892.1 | DUF2157 domain-containing protein | - |
| N4558_RS19180 (N4558_19175) | 3980437..3981303 | - | 867 | WP_004151823.1 | helix-turn-helix transcriptional regulator | - |
| N4558_RS19185 (N4558_19180) | 3981412..3982839 | + | 1428 | WP_009308097.1 | MFS transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12110.39 Da Isoelectric Point: 11.2767
>T257823 WP_004142563.1 NZ_CP104373:c3978539-3978222 [Klebsiella pneumoniae]
MFRLVVHVDVKKELQALPPIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
MFRLVVHVDVKKELQALPPIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0M5MXH8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0S3DIQ1 |