Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 711236..712011 | Replicon | chromosome |
Accession | NZ_CP104373 | ||
Organism | Klebsiella pneumoniae strain 2021CK-01815 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | A0A331A5C5 |
Locus tag | N4558_RS03510 | Protein ID | WP_019704987.1 |
Coordinates | 711526..712011 (+) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | W8UEW1 |
Locus tag | N4558_RS03505 | Protein ID | WP_004150912.1 |
Coordinates | 711236..711529 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4558_RS03485 (N4558_03485) | 706445..707047 | - | 603 | WP_019704985.1 | short chain dehydrogenase | - |
N4558_RS03490 (N4558_03490) | 707145..708056 | + | 912 | WP_017879796.1 | LysR family transcriptional regulator | - |
N4558_RS03495 (N4558_03495) | 708057..709205 | - | 1149 | WP_019704986.1 | PLP-dependent aspartate aminotransferase family protein | - |
N4558_RS03500 (N4558_03500) | 709216..710592 | - | 1377 | WP_017879795.1 | pyridoxal-phosphate dependent enzyme | - |
N4558_RS03505 (N4558_03505) | 711236..711529 | + | 294 | WP_004150912.1 | DUF1778 domain-containing protein | Antitoxin |
N4558_RS03510 (N4558_03510) | 711526..712011 | + | 486 | WP_019704987.1 | GNAT family N-acetyltransferase | Toxin |
N4558_RS03515 (N4558_03515) | 712715..713308 | + | 594 | WP_004188553.1 | hypothetical protein | - |
N4558_RS03520 (N4558_03520) | 713405..713621 | + | 217 | Protein_691 | transposase | - |
N4558_RS03530 (N4558_03530) | 714462..715175 | - | 714 | WP_002916694.1 | DUF554 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 713405..713557 | 152 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17572.56 Da Isoelectric Point: 8.5111
>T257816 WP_019704987.1 NZ_CP104373:711526-712011 [Klebsiella pneumoniae]
MISAPEPLNAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPDPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
MISAPEPLNAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPDPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A331A5C5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GVL4 |