Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 4057700..4058394 | Replicon | chromosome |
Accession | NZ_CP104371 | ||
Organism | Escherichia coli strain 2021CK-01784 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | V0YKG6 |
Locus tag | N4502_RS19505 | Protein ID | WP_001263485.1 |
Coordinates | 4057996..4058394 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | S1QAE3 |
Locus tag | N4502_RS19500 | Protein ID | WP_000554758.1 |
Coordinates | 4057700..4057993 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4502_RS19480 (4053117) | 4053117..4053614 | + | 498 | WP_000006263.1 | REP-associated tyrosine transposase RayT | - |
N4502_RS19485 (4054053) | 4054053..4055765 | - | 1713 | Protein_3800 | flagellar biosynthesis protein FlhA | - |
N4502_RS19490 (4055737) | 4055737..4056522 | + | 786 | WP_000207554.1 | putative lateral flagellar export/assembly protein LafU | - |
N4502_RS19495 (4056593) | 4056593..4057648 | + | 1056 | WP_001226177.1 | DNA polymerase IV | - |
N4502_RS19500 (4057700) | 4057700..4057993 | + | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
N4502_RS19505 (4057996) | 4057996..4058394 | + | 399 | WP_001263485.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
N4502_RS19510 (4058404) | 4058404..4058856 | + | 453 | WP_001059899.1 | GNAT family N-acetyltransferase | - |
N4502_RS19515 (4059102) | 4059102..4059308 | + | 207 | Protein_3806 | RtcB family protein | - |
N4502_RS19520 (4059304) | 4059304..4059656 | + | 353 | Protein_3807 | peptide chain release factor H | - |
N4502_RS19525 (4059713) | 4059713..4061170 | - | 1458 | WP_001293009.1 | cytosol nonspecific dipeptidase | - |
N4502_RS19530 (4061431) | 4061431..4061889 | + | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
- (4062485) | 4062485..4062565 | + | 81 | NuclAT_11 | - | - |
- (4062485) | 4062485..4062565 | + | 81 | NuclAT_11 | - | - |
- (4062485) | 4062485..4062565 | + | 81 | NuclAT_11 | - | - |
- (4062485) | 4062485..4062565 | + | 81 | NuclAT_11 | - | - |
N4502_RS19535 (4061981) | 4061981..4063225 | + | 1245 | WP_000189541.1 | esterase FrsA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15418.84 Da Isoelectric Point: 7.3840
>T257812 WP_001263485.1 NZ_CP104371:4057996-4058394 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGILPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLCQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGILPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLCQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|