Detailed information of TA system
Overview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 3786164..3786422 | Replicon | chromosome |
Accession | NZ_CP104371 | ||
Organism | Escherichia coli strain 2021CK-01784 |
Toxin (Protein)
Gene name | hokC | Uniprot ID | S1NX00 |
Locus tag | N4502_RS18270 | Protein ID | WP_000809168.1 |
Coordinates | 3786164..3786316 (-) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | sokC | ||
Locus tag | - | ||
Coordinates | 3786365..3786422 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4502_RS18250 | 3781406..3782119 | - | 714 | WP_001102367.1 | acidic protein MsyB | - |
N4502_RS18255 | 3782145..3782549 | - | 405 | WP_000843584.1 | DUF2541 family protein | - |
N4502_RS18260 | 3782925..3784841 | + | 1917 | WP_000516135.1 | molecular chaperone DnaK | - |
N4502_RS18265 | 3784930..3786060 | + | 1131 | WP_001118454.1 | molecular chaperone DnaJ | - |
N4502_RS18270 | 3786164..3786316 | - | 153 | WP_000809168.1 | type I toxin-antitoxin system toxin MokC | Toxin |
- | 3786365..3786422 | + | 58 | - | - | Antitoxin |
N4502_RS18275 | 3786902..3788068 | + | 1167 | WP_000681360.1 | Na+/H+ antiporter NhaA | - |
N4502_RS18280 | 3788134..3789033 | + | 900 | WP_001300855.1 | transcriptional activator NhaR | - |
N4502_RS18285 | 3789071..3790030 | - | 960 | WP_260837266.1 | fimbrial family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5501.57 Da Isoelectric Point: 7.1312
>T257811 WP_000809168.1 NZ_CP104371:c3786316-3786164 [Escherichia coli]
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
Download Length: 153 bp
Antitoxin
Download Length: 58 bp
>AT257811 NZ_CP104371:3786365-3786422 [Escherichia coli]
GTTCAGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
GTTCAGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|