Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 2299363..2300162 | Replicon | chromosome |
| Accession | NZ_CP104371 | ||
| Organism | Escherichia coli strain 2021CK-01784 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | A0A369FDQ4 |
| Locus tag | N4502_RS11155 | Protein ID | WP_000347280.1 |
| Coordinates | 2299698..2300162 (+) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | S1EB98 |
| Locus tag | N4502_RS11150 | Protein ID | WP_001307405.1 |
| Coordinates | 2299363..2299698 (+) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4502_RS11135 (2295148) | 2295148..2295918 | - | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
| N4502_RS11140 (2295934) | 2295934..2297268 | - | 1335 | WP_000599651.1 | galactarate/glucarate/glycerate transporter GarP | - |
| N4502_RS11145 (2297643) | 2297643..2299214 | + | 1572 | WP_001273738.1 | galactarate dehydratase | - |
| N4502_RS11150 (2299363) | 2299363..2299698 | + | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| N4502_RS11155 (2299698) | 2299698..2300162 | + | 465 | WP_000347280.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| N4502_RS11160 (2300217) | 2300217..2301026 | - | 810 | WP_000072171.1 | aga operon transcriptional regulator AgaR | - |
| N4502_RS11165 (2301275) | 2301275..2302555 | + | 1281 | WP_000681960.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| N4502_RS11170 (2302578) | 2302578..2303051 | + | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| N4502_RS11175 (2303062) | 2303062..2303841 | + | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
| N4502_RS11180 (2303831) | 2303831..2304709 | + | 879 | WP_039720218.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
| N4502_RS11185 (2304727) | 2304727..2305161 | + | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 2290123..2300162 | 10039 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17862.29 Da Isoelectric Point: 9.6924
>T257806 WP_000347280.1 NZ_CP104371:2299698-2300162 [Escherichia coli]
MDFPQRVNSWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEEPH
MDFPQRVNSWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEEPH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A369FDQ4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XVC7 |