Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4668435..4669189 | Replicon | chromosome |
| Accession | NZ_CP104366 | ||
| Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain PNUSAS028809 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | B5F003 |
| Locus tag | N4533_RS22710 | Protein ID | WP_000558166.1 |
| Coordinates | 4668435..4668746 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | N4533_RS22715 | Protein ID | WP_001259011.1 |
| Coordinates | 4668743..4669189 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4533_RS22680 (4664093) | 4664093..4664995 | + | 903 | WP_000331361.1 | formate dehydrogenase subunit beta | - |
| N4533_RS22685 (4664992) | 4664992..4665627 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| N4533_RS22690 (4665624) | 4665624..4666553 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| N4533_RS22695 (4666600) | 4666600..4666890 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | - |
| N4533_RS22700 (4666891) | 4666891..4667202 | - | 312 | WP_001159630.1 | cytotoxic translational repressor of toxin-antitoxin stability system | - |
| N4533_RS22705 (4667420) | 4667420..4668349 | + | 930 | WP_001127703.1 | alpha/beta hydrolase | - |
| N4533_RS22710 (4668435) | 4668435..4668746 | + | 312 | WP_000558166.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| N4533_RS22715 (4668743) | 4668743..4669189 | + | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| N4533_RS22720 (4669204) | 4669204..4670145 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| N4533_RS22725 (4670190) | 4670190..4670627 | - | 438 | WP_000560974.1 | D-aminoacyl-tRNA deacylase | - |
| N4533_RS22730 (4670624) | 4670624..4671496 | - | 873 | WP_000921427.1 | virulence factor BrkB family protein | - |
| N4533_RS22735 (4671490) | 4671490..4672089 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
| N4533_RS22740 (4672280) | 4672280..4673083 | - | 804 | WP_000059693.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| N4533_RS22745 (4673117) | 4673117..4674013 | - | 897 | WP_001520529.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12432.40 Da Isoelectric Point: 9.5334
>T257792 WP_000558166.1 NZ_CP104366:4668435-4668746 [Salmonella enterica subsp. enterica serovar Typhimurium]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16734.08 Da Isoelectric Point: 6.6451
>AT257792 WP_001259011.1 NZ_CP104366:4668743-4669189 [Salmonella enterica subsp. enterica serovar Typhimurium]
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|