Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 2427079..2427601 | Replicon | chromosome |
Accession | NZ_CP104366 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain PNUSAS028809 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | B5F5Y5 |
Locus tag | N4533_RS11830 | Protein ID | WP_000221343.1 |
Coordinates | 2427317..2427601 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | V1H457 |
Locus tag | N4533_RS11825 | Protein ID | WP_000885424.1 |
Coordinates | 2427079..2427327 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4533_RS11800 (2422295) | 2422295..2423761 | + | 1467 | WP_000987828.1 | hypothetical protein | - |
N4533_RS11805 (2424569) | 2424569..2425283 | + | 715 | Protein_2308 | helix-turn-helix domain-containing protein | - |
N4533_RS11810 (2425339) | 2425339..2426247 | - | 909 | WP_010989018.1 | hypothetical protein | - |
N4533_RS11815 (2426390) | 2426390..2426722 | - | 333 | WP_000253154.1 | DUF1493 family protein | - |
N4533_RS11820 (2426712) | 2426712..2426927 | - | 216 | WP_000206207.1 | hypothetical protein | - |
N4533_RS11825 (2427079) | 2427079..2427327 | + | 249 | WP_000885424.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
N4533_RS11830 (2427317) | 2427317..2427601 | + | 285 | WP_000221343.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N4533_RS11835 (2427772) | 2427772..2428161 | + | 390 | WP_000194089.1 | RidA family protein | - |
N4533_RS11840 (2428213) | 2428213..2429292 | - | 1080 | WP_000954688.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
N4533_RS11845 (2429485) | 2429485..2429973 | - | 489 | WP_001293638.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
N4533_RS11850 (2430018) | 2430018..2431526 | + | 1509 | WP_000199411.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 2422298..2434383 | 12085 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11075.85 Da Isoelectric Point: 10.6500
>T257784 WP_000221343.1 NZ_CP104366:2427317-2427601 [Salmonella enterica subsp. enterica serovar Typhimurium]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JSW4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0WPN5 |