Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/Tad-HTH_37 |
Location | 1139486..1140084 | Replicon | chromosome |
Accession | NZ_CP104354 | ||
Organism | Vibrio cholerae strain PNUSAV001140 |
Toxin (Protein)
Gene name | higB | Uniprot ID | I1YFL9 |
Locus tag | N4267_RS05350 | Protein ID | WP_001896384.1 |
Coordinates | 1139761..1140084 (-) | Length | 108 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | N4267_RS05345 | Protein ID | WP_000058216.1 |
Coordinates | 1139486..1139764 (-) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4267_RS05330 (N4267_05330) | 1136448..1138268 | + | 1821 | WP_032468029.1 | conjugative transfer system coupling protein TraD | - |
N4267_RS05335 (N4267_05335) | 1138278..1138838 | + | 561 | WP_001896321.1 | hypothetical protein | - |
N4267_RS05340 (N4267_05340) | 1138825..1139460 | + | 636 | WP_001896322.1 | DUF4400 domain-containing protein | - |
N4267_RS05345 (N4267_05345) | 1139486..1139764 | - | 279 | WP_000058216.1 | helix-turn-helix transcriptional regulator | Antitoxin |
N4267_RS05350 (N4267_05350) | 1139761..1140084 | - | 324 | WP_001896384.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N4267_RS05355 (N4267_05355) | 1140265..1140546 | + | 282 | WP_000433891.1 | type IV conjugative transfer system protein TraL | - |
N4267_RS05360 (N4267_05360) | 1140543..1141169 | + | 627 | WP_001896361.1 | TraE/TraK family type IV conjugative transfer system protein | - |
N4267_RS05365 (N4267_05365) | 1141153..1142049 | + | 897 | WP_001896336.1 | type-F conjugative transfer system secretin TraK | - |
N4267_RS05370 (N4267_05370) | 1142052..1143341 | + | 1290 | WP_134987188.1 | TraB/VirB10 family protein | - |
N4267_RS05375 (N4267_05375) | 1143416..1143988 | + | 573 | WP_147422779.1 | type IV conjugative transfer system lipoprotein TraV | - |
N4267_RS05380 (N4267_05380) | 1143985..1144371 | + | 387 | WP_001896311.1 | TraA family conjugative transfer protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 1124504..1229432 | 104928 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 108 a.a. Molecular weight: 12281.33 Da Isoelectric Point: 9.7658
>T257712 WP_001896384.1 NZ_CP104354:c1140084-1139761 [Vibrio cholerae]
MSWKIDFYDGVEDQILDMPPKIQARMIKLLELMEKHGANLGPPHTESMGDGLFEIRAKAQEGIGRGLFCYLKGKHIYVLH
AFVKKSQKTPKNELNLARDRQKEVQKS
MSWKIDFYDGVEDQILDMPPKIQARMIKLLELMEKHGANLGPPHTESMGDGLFEIRAKAQEGIGRGLFCYLKGKHIYVLH
AFVKKSQKTPKNELNLARDRQKEVQKS
Download Length: 324 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|