257711

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/RelE-HTH
Location 189525..190110 Replicon plasmid unnamed1
Accession NZ_CP104352
Organism Acinetobacter baumannii strain 2021CK-01335

Toxin (Protein)


Gene name higB Uniprot ID N9CJF7
Locus tag N4T38_RS20950 Protein ID WP_000897307.1
Coordinates 189525..189845 (+) Length 107 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag N4T38_RS20955 Protein ID WP_000369781.1
Coordinates 189838..190110 (+) Length 91 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N4T38_RS20910 (N4T38_20910) 184830..185666 + 837 WP_040110386.1 APH(6)-I family aminoglycoside O-phosphotransferase -
N4T38_RS20915 (N4T38_20915) 185856..186143 + 288 WP_000438825.1 BrnT family toxin -
N4T38_RS20920 (N4T38_20920) 186130..186444 + 315 WP_004728120.1 BrnA antitoxin family protein -
N4T38_RS20925 (N4T38_20925) 186611..187054 - 444 WP_260744098.1 hypothetical protein -
N4T38_RS20930 (N4T38_20930) 187132..188100 + 969 WP_252513945.1 IS30 family transposase -
N4T38_RS20935 (N4T38_20935) 188302..188604 + 303 WP_000286964.1 type II toxin-antitoxin system RelE/ParE family toxin -
N4T38_RS20940 (N4T38_20940) 188605..188886 + 282 WP_000985609.1 putative addiction module antidote protein -
N4T38_RS20945 (N4T38_20945) 188966..189385 - 420 WP_001180106.1 SMI1/KNR4 family protein -
N4T38_RS20950 (N4T38_20950) 189525..189845 + 321 WP_000897307.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
N4T38_RS20955 (N4T38_20955) 189838..190110 + 273 WP_000369781.1 NadS family protein Antitoxin
N4T38_RS20960 (N4T38_20960) 190603..192078 + 1476 WP_000052512.1 ABC-F type ribosomal protection protein Msr(E) -
N4T38_RS20965 (N4T38_20965) 192134..193018 + 885 WP_000155092.1 Mph(E) family macrolide 2'-phosphotransferase -
N4T38_RS20970 (N4T38_20970) 193208..193819 - 612 WP_015060246.1 recombinase family protein -
N4T38_RS20975 (N4T38_20975) 194075..194491 + 417 WP_000147519.1 hypothetical protein -
N4T38_RS20980 (N4T38_20980) 194512..194754 + 243 WP_001229660.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid tet(X3) / sul2 / aph(3'')-Ib / aph(6)-Id / msr(E) / mph(E) / ARR-3 / qacE / sul1 / blaNDM-1 / aph(3')-VI / blaOXA-58 - 1..335718 335718
- inside IScluster/Tn aph(3'')-Ib / aph(6)-Id / msr(E) / mph(E) - 175189..193018 17829


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-2

(41-102)

Antitoxin

Cro/C1-type helix-turn-helix domain

(37-85)


Sequences

Toxin        


Download         Length: 107 a.a.        Molecular weight: 12187.95 Da        Isoelectric Point: 7.1639

>T257711 WP_000897307.1 NZ_CP104352:189525-189845 [Acinetobacter baumannii]
MLFIETSIFTKQIKDLVSDEEYRQLQQDLLVQPDRGDLIKNGGGIRKVRCAQGNKGKSGGIRVIYYWVTEDDQIFFLVAY
PKSVKDNLTDKETAILHQLVKEQFHG

Download         Length: 321 bp

Antitoxin


Download         Length: 91 a.a.        Molecular weight: 10149.61 Da        Isoelectric Point: 8.6582

>AT257711 WP_000369781.1 NZ_CP104352:189838-190110 [Acinetobacter baumannii]
MDNNLFDDLVASIKEAGAIKRKEVKASRVTELELPDIKEVREKTGLSQNEFAARLHISPRTLQNWEQGRRYPTGPAATLI
RILDAHPSLI

Download         Length: 273 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0A8TMZ3

Antitoxin

Source ID Structure

References