257701

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/RelE-HTH
Location 10642..11227 Replicon plasmid unnamed2
Accession NZ_CP104348
Organism Acinetobacter baumannii strain 2021CK-01333

Toxin (Protein)


Gene name higB Uniprot ID N9CJF7
Locus tag N4T37_RS00075 Protein ID WP_000897307.1
Coordinates 10907..11227 (-) Length 107 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag N4T37_RS00070 Protein ID WP_000369781.1
Coordinates 10642..10914 (-) Length 91 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N4T37_RS00045 (N4T37_00045) 5998..6240 - 243 WP_001229660.1 hypothetical protein -
N4T37_RS00050 (N4T37_00050) 6261..6677 - 417 WP_000147519.1 hypothetical protein -
N4T37_RS00055 (N4T37_00055) 6933..7544 + 612 WP_015060246.1 recombinase family protein -
N4T37_RS00060 (N4T37_00060) 7734..8618 - 885 WP_000155092.1 Mph(E) family macrolide 2'-phosphotransferase -
N4T37_RS00065 (N4T37_00065) 8674..10149 - 1476 WP_000052512.1 ABC-F type ribosomal protection protein Msr(E) -
N4T37_RS00070 (N4T37_00070) 10642..10914 - 273 WP_000369781.1 NadS family protein Antitoxin
N4T37_RS00075 (N4T37_00075) 10907..11227 - 321 WP_000897307.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
N4T37_RS00080 (N4T37_00080) 11367..11786 + 420 WP_001180106.1 SMI1/KNR4 family protein -
N4T37_RS00085 (N4T37_00085) 11866..12147 - 282 WP_000985609.1 putative addiction module antidote protein -
N4T37_RS00090 (N4T37_00090) 12148..12450 - 303 WP_000286964.1 type II toxin-antitoxin system RelE/ParE family toxin -
N4T37_RS00095 (N4T37_00095) 12652..13620 - 969 WP_252513945.1 IS30 family transposase -
N4T37_RS00100 (N4T37_00100) 13698..14141 + 444 WP_260744098.1 hypothetical protein -
N4T37_RS00105 (N4T37_00105) 14308..14622 - 315 WP_004728120.1 BrnA antitoxin family protein -
N4T37_RS00110 (N4T37_00110) 14609..14896 - 288 WP_000438825.1 BrnT family toxin -
N4T37_RS00115 (N4T37_00115) 15086..15922 - 837 WP_040110386.1 APH(6)-I family aminoglycoside O-phosphotransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid mph(E) / msr(E) / aph(6)-Id / aph(3'')-Ib / sul2 / tet(X3) / blaOXA-58 / aph(3')-VI / blaNDM-1 / ARR-3 - 1..335558 335558
- inside IScluster/Tn mph(E) / msr(E) / aph(6)-Id / aph(3'')-Ib - 7734..25563 17829


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-2

(41-102)

Antitoxin

Cro/C1-type helix-turn-helix domain

(37-85)


Sequences

Toxin        


Download         Length: 107 a.a.        Molecular weight: 12187.95 Da        Isoelectric Point: 7.1639

>T257701 WP_000897307.1 NZ_CP104348:c11227-10907 [Acinetobacter baumannii]
MLFIETSIFTKQIKDLVSDEEYRQLQQDLLVQPDRGDLIKNGGGIRKVRCAQGNKGKSGGIRVIYYWVTEDDQIFFLVAY
PKSVKDNLTDKETAILHQLVKEQFHG

Download         Length: 321 bp

Antitoxin


Download         Length: 91 a.a.        Molecular weight: 10149.61 Da        Isoelectric Point: 8.6582

>AT257701 WP_000369781.1 NZ_CP104348:c10914-10642 [Acinetobacter baumannii]
MDNNLFDDLVASIKEAGAIKRKEVKASRVTELELPDIKEVREKTGLSQNEFAARLHISPRTLQNWEQGRRYPTGPAATLI
RILDAHPSLI

Download         Length: 273 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0A8TMZ3

Antitoxin

Source ID Structure

References