257692

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/RelE-HTH
Location 199938..200523 Replicon plasmid unnamed1
Accession NZ_CP104343
Organism Acinetobacter baumannii strain 2021CK-01300

Toxin (Protein)


Gene name higB Uniprot ID N9CJF7
Locus tag N4T35_RS21215 Protein ID WP_000897307.1
Coordinates 200203..200523 (-) Length 107 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag N4T35_RS21210 Protein ID WP_000369781.1
Coordinates 199938..200210 (-) Length 91 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N4T35_RS21185 (N4T35_21185) 195294..195536 - 243 WP_001229660.1 hypothetical protein -
N4T35_RS21190 (N4T35_21190) 195557..195973 - 417 WP_000147519.1 hypothetical protein -
N4T35_RS21195 (N4T35_21195) 196229..196840 + 612 WP_015060246.1 recombinase family protein -
N4T35_RS21200 (N4T35_21200) 197030..197914 - 885 WP_000155092.1 Mph(E) family macrolide 2'-phosphotransferase -
N4T35_RS21205 (N4T35_21205) 197970..199445 - 1476 WP_000052512.1 ABC-F type ribosomal protection protein Msr(E) -
N4T35_RS21210 (N4T35_21210) 199938..200210 - 273 WP_000369781.1 NadS family protein Antitoxin
N4T35_RS21215 (N4T35_21215) 200203..200523 - 321 WP_000897307.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
N4T35_RS21220 (N4T35_21220) 200663..201082 + 420 WP_001180106.1 SMI1/KNR4 family protein -
N4T35_RS21225 (N4T35_21225) 201162..201443 - 282 WP_000985609.1 putative addiction module antidote protein -
N4T35_RS21230 (N4T35_21230) 201444..201746 - 303 WP_000286964.1 type II toxin-antitoxin system RelE/ParE family toxin -
N4T35_RS21235 (N4T35_21235) 201948..202916 - 969 WP_260785412.1 IS30 family transposase -
N4T35_RS21240 (N4T35_21240) 202994..203437 + 444 WP_260744098.1 hypothetical protein -
N4T35_RS21245 (N4T35_21245) 203604..203918 - 315 WP_004728120.1 BrnA antitoxin family protein -
N4T35_RS21250 (N4T35_21250) 203905..204192 - 288 WP_000438825.1 BrnT family toxin -
N4T35_RS21255 (N4T35_21255) 204382..205218 - 837 WP_040110386.1 APH(6)-I family aminoglycoside O-phosphotransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid blaOXA-58 / aph(3')-VI / blaNDM-1 / sul1 / qacE / ARR-3 / mph(E) / msr(E) / aph(6)-Id / aph(3'')-Ib / sul2 / tet(X3) - 1..335718 335718
- inside IScluster/Tn mph(E) / msr(E) / aph(6)-Id / aph(3'')-Ib - 197030..214859 17829


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-2

(41-102)

Antitoxin

Cro/C1-type helix-turn-helix domain

(37-85)


Sequences

Toxin        


Download         Length: 107 a.a.        Molecular weight: 12187.95 Da        Isoelectric Point: 7.1639

>T257692 WP_000897307.1 NZ_CP104343:c200523-200203 [Acinetobacter baumannii]
MLFIETSIFTKQIKDLVSDEEYRQLQQDLLVQPDRGDLIKNGGGIRKVRCAQGNKGKSGGIRVIYYWVTEDDQIFFLVAY
PKSVKDNLTDKETAILHQLVKEQFHG

Download         Length: 321 bp

Antitoxin


Download         Length: 91 a.a.        Molecular weight: 10149.61 Da        Isoelectric Point: 8.6582

>AT257692 WP_000369781.1 NZ_CP104343:c200210-199938 [Acinetobacter baumannii]
MDNNLFDDLVASIKEAGAIKRKEVKASRVTELELPDIKEVREKTGLSQNEFAARLHISPRTLQNWEQGRRYPTGPAATLI
RILDAHPSLI

Download         Length: 273 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0A8TMZ3

Antitoxin

Source ID Structure

References