Detailed information of TA system TA257675

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 121868..122294
• Replicon: plasmid pHB42-F3
• Accession: NZ_CP104331
• Organism: Escherichia coli strain THB42-F3

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: N0544_RS23040
• Protein ID: WP_001372321.1
• Coordinates: 122169..122294 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	121868..122092 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
N0544_RS23005 (117027)	117027..117488	-	462	Protein_128	hypothetical protein	-
N0544_RS23010 (117790)	117790..118317	+	528	WP_000290834.1	single-stranded DNA-binding protein	-
N0544_RS23015 (118375)	118375..118608	+	234	WP_000006003.1	DUF905 family protein	-
N0544_RS23020 (118669)	118669..120637	+	1969	Protein_131	ParB/RepB/Spo0J family partition protein	-
N0544_RS23025 (120706)	120706..121140	+	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
N0544_RS23030 (121137)	121137..121899	+	763	Protein_133	plasmid SOS inhibition protein A	-
- (121868)	121868..122092	+	225	NuclAT_0	-	Antitoxin
- (121868)	121868..122092	+	225	NuclAT_0	-	Antitoxin
- (121868)	121868..122092	+	225	NuclAT_0	-	Antitoxin
- (121868)	121868..122092	+	225	NuclAT_0	-	Antitoxin
N0544_RS23035 (122078)	122078..122227	+	150	Protein_134	plasmid maintenance protein Mok	-
N0544_RS23040 (122169)	122169..122294	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
N0544_RS23045 (122613)	122613..122909	-	297	Protein_136	hypothetical protein	-
N0544_RS23050 (123209)	123209..123505	+	297	WP_001272251.1	hypothetical protein	-
N0544_RS23055 (123616)	123616..124437	+	822	WP_001234445.1	DUF932 domain-containing protein	-
N0544_RS23060 (124734)	124734..125381	-	648	WP_015059008.1	transglycosylase SLT domain-containing protein	-
N0544_RS23065 (125658)	125658..126041	+	384	WP_000124981.1	conjugal transfer relaxosome DNA-binding protein TraM	-
N0544_RS23070 (126232)	126232..126918	+	687	WP_015059009.1	PAS domain-containing protein	-
N0544_RS23075 (127012)	127012..127239	+	228	WP_001254386.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	dfrA12 / aadA2 / qacE / mph(A) / aph(3')-IIa / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / floR / blaTEM-1B / rmtB / blaCTX-M-55	-	1..161931	161931

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T257675 WP_001372321.1 NZ_CP104331:122169-122294 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT257675 NZ_CP104331:121868-122092 [Escherichia coli]
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin