Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 121868..122294 | Replicon | plasmid pHB42-F3 |
| Accession | NZ_CP104331 | ||
| Organism | Escherichia coli strain THB42-F3 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | N0544_RS23040 | Protein ID | WP_001372321.1 |
| Coordinates | 122169..122294 (+) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 121868..122092 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N0544_RS23005 (117027) | 117027..117488 | - | 462 | Protein_128 | hypothetical protein | - |
| N0544_RS23010 (117790) | 117790..118317 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
| N0544_RS23015 (118375) | 118375..118608 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
| N0544_RS23020 (118669) | 118669..120637 | + | 1969 | Protein_131 | ParB/RepB/Spo0J family partition protein | - |
| N0544_RS23025 (120706) | 120706..121140 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
| N0544_RS23030 (121137) | 121137..121899 | + | 763 | Protein_133 | plasmid SOS inhibition protein A | - |
| - (121868) | 121868..122092 | + | 225 | NuclAT_0 | - | Antitoxin |
| - (121868) | 121868..122092 | + | 225 | NuclAT_0 | - | Antitoxin |
| - (121868) | 121868..122092 | + | 225 | NuclAT_0 | - | Antitoxin |
| - (121868) | 121868..122092 | + | 225 | NuclAT_0 | - | Antitoxin |
| N0544_RS23035 (122078) | 122078..122227 | + | 150 | Protein_134 | plasmid maintenance protein Mok | - |
| N0544_RS23040 (122169) | 122169..122294 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| N0544_RS23045 (122613) | 122613..122909 | - | 297 | Protein_136 | hypothetical protein | - |
| N0544_RS23050 (123209) | 123209..123505 | + | 297 | WP_001272251.1 | hypothetical protein | - |
| N0544_RS23055 (123616) | 123616..124437 | + | 822 | WP_001234445.1 | DUF932 domain-containing protein | - |
| N0544_RS23060 (124734) | 124734..125381 | - | 648 | WP_015059008.1 | transglycosylase SLT domain-containing protein | - |
| N0544_RS23065 (125658) | 125658..126041 | + | 384 | WP_000124981.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| N0544_RS23070 (126232) | 126232..126918 | + | 687 | WP_015059009.1 | PAS domain-containing protein | - |
| N0544_RS23075 (127012) | 127012..127239 | + | 228 | WP_001254386.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | dfrA12 / aadA2 / qacE / mph(A) / aph(3')-IIa / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / floR / blaTEM-1B / rmtB / blaCTX-M-55 | - | 1..161931 | 161931 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T257675 WP_001372321.1 NZ_CP104331:122169-122294 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 225 bp
>AT257675 NZ_CP104331:121868-122092 [Escherichia coli]
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|