Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | symER/SymE(toxin) |
Location | 3904174..3904586 | Replicon | chromosome |
Accession | NZ_CP104330 | ||
Organism | Escherichia coli strain THB42-F3 |
Toxin (Protein)
Gene name | symE | Uniprot ID | U9YSY7 |
Locus tag | N0544_RS19055 | Protein ID | WP_000132601.1 |
Coordinates | 3904245..3904586 (+) | Length | 114 a.a. |
Antitoxin (RNA)
Gene name | symR | ||
Locus tag | - | ||
Coordinates | 3904174..3904250 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N0544_RS19045 (3901037) | 3901037..3902626 | + | 1590 | WP_001063204.1 | type I restriction-modification system methyltransferase | - |
N0544_RS19050 (3902623) | 3902623..3904017 | + | 1395 | WP_072647344.1 | type I restriction-modification system specificity subunit | - |
- (3904174) | 3904174..3904250 | - | 77 | NuclAT_14 | - | Antitoxin |
- (3904174) | 3904174..3904250 | - | 77 | NuclAT_14 | - | Antitoxin |
- (3904174) | 3904174..3904250 | - | 77 | NuclAT_14 | - | Antitoxin |
- (3904174) | 3904174..3904250 | - | 77 | NuclAT_14 | - | Antitoxin |
- (3904174) | 3904174..3904250 | - | 77 | NuclAT_15 | - | Antitoxin |
- (3904174) | 3904174..3904250 | - | 77 | NuclAT_15 | - | Antitoxin |
- (3904174) | 3904174..3904250 | - | 77 | NuclAT_15 | - | Antitoxin |
- (3904174) | 3904174..3904250 | - | 77 | NuclAT_15 | - | Antitoxin |
N0544_RS19055 (3904245) | 3904245..3904586 | + | 342 | WP_000132601.1 | endoribonuclease SymE | Toxin |
N0544_RS19060 (3904748) | 3904748..3906127 | + | 1380 | WP_072647343.1 | 5-methylcytosine-specific restriction endonuclease subunit McrB | - |
N0544_RS19065 (3906127) | 3906127..3907173 | + | 1047 | WP_000437621.1 | 5-methylcytosine-specific restriction endonuclease system specificity protein McrC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12203.02 Da Isoelectric Point: 8.5012
>T257667 WP_000132601.1 NZ_CP104330:3904245-3904586 [Escherichia coli]
MTDTHSIAQPFEAEVSPANNRHVTVGYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAAEESE
LMQSLRQVCKLSARKQKQVQAFIGVIAGKQKVA
MTDTHSIAQPFEAEVSPANNRHVTVGYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAAEESE
LMQSLRQVCKLSARKQKQVQAFIGVIAGKQKVA
Download Length: 342 bp
Antitoxin
Download Length: 77 bp
>AT257667 NZ_CP104330:c3904250-3904174 [Escherichia coli]
AGTCATAACTGCTATTCTCCAGGAATAGTGATTGTGATTAGCGATGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
AGTCATAACTGCTATTCTCCAGGAATAGTGATTGTGATTAGCGATGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|