Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 3589735..3590429 | Replicon | chromosome |
| Accession | NZ_CP104330 | ||
| Organism | Escherichia coli strain THB42-F3 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | Q47157 |
| Locus tag | N0544_RS17575 | Protein ID | WP_001263489.1 |
| Coordinates | 3589735..3590133 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | S1QAE3 |
| Locus tag | N0544_RS17580 | Protein ID | WP_000554758.1 |
| Coordinates | 3590136..3590429 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| - (3585323) | 3585323..3585403 | - | 81 | NuclAT_12 | - | - |
| - (3585323) | 3585323..3585403 | - | 81 | NuclAT_12 | - | - |
| - (3585323) | 3585323..3585403 | - | 81 | NuclAT_12 | - | - |
| - (3585323) | 3585323..3585403 | - | 81 | NuclAT_12 | - | - |
| N0544_RS17550 (3585999) | 3585999..3586457 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
| N0544_RS17555 (3586718) | 3586718..3588175 | + | 1458 | WP_001292994.1 | cytosol nonspecific dipeptidase | - |
| N0544_RS17560 (3588232) | 3588232..3588753 | - | 522 | Protein_3431 | peptide chain release factor H | - |
| N0544_RS17565 (3588749) | 3588749..3588955 | - | 207 | Protein_3432 | RtcB family protein | - |
| N0544_RS17570 (3589273) | 3589273..3589725 | - | 453 | WP_001059892.1 | GNAT family N-acetyltransferase | - |
| N0544_RS17575 (3589735) | 3589735..3590133 | - | 399 | WP_001263489.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| N0544_RS17580 (3590136) | 3590136..3590429 | - | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| N0544_RS17585 (3590481) | 3590481..3591536 | - | 1056 | WP_001226164.1 | DNA polymerase IV | - |
| N0544_RS17590 (3591607) | 3591607..3592392 | - | 786 | WP_000207552.1 | putative lateral flagellar export/assembly protein LafU | - |
| N0544_RS17595 (3592364) | 3592364..3594076 | + | 1713 | Protein_3438 | flagellar biosynthesis protein FlhA | - |
| N0544_RS17600 (3594300) | 3594300..3594797 | - | 498 | WP_000006255.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15487.84 Da Isoelectric Point: 7.4215
>T257665 WP_001263489.1 NZ_CP104330:c3590133-3589735 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A090J8B1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1QAE3 |