Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 3588839..3589533 | Replicon | chromosome |
| Accession | NZ_CP104328 | ||
| Organism | Escherichia coli strain THB42-F2 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | Q47157 |
| Locus tag | N0499_RS17565 | Protein ID | WP_001263489.1 |
| Coordinates | 3588839..3589237 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | S1QAE3 |
| Locus tag | N0499_RS17570 | Protein ID | WP_000554758.1 |
| Coordinates | 3589240..3589533 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| - (3584427) | 3584427..3584507 | - | 81 | NuclAT_12 | - | - |
| - (3584427) | 3584427..3584507 | - | 81 | NuclAT_12 | - | - |
| - (3584427) | 3584427..3584507 | - | 81 | NuclAT_12 | - | - |
| - (3584427) | 3584427..3584507 | - | 81 | NuclAT_12 | - | - |
| N0499_RS17540 (3585103) | 3585103..3585561 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
| N0499_RS17545 (3585822) | 3585822..3587279 | + | 1458 | WP_001292994.1 | cytosol nonspecific dipeptidase | - |
| N0499_RS17550 (3587336) | 3587336..3587857 | - | 522 | Protein_3429 | peptide chain release factor H | - |
| N0499_RS17555 (3587853) | 3587853..3588059 | - | 207 | Protein_3430 | RtcB family protein | - |
| N0499_RS17560 (3588377) | 3588377..3588829 | - | 453 | WP_001059892.1 | GNAT family N-acetyltransferase | - |
| N0499_RS17565 (3588839) | 3588839..3589237 | - | 399 | WP_001263489.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| N0499_RS17570 (3589240) | 3589240..3589533 | - | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| N0499_RS17575 (3589585) | 3589585..3590640 | - | 1056 | WP_001226164.1 | DNA polymerase IV | - |
| N0499_RS17580 (3590711) | 3590711..3591496 | - | 786 | WP_000207552.1 | putative lateral flagellar export/assembly protein LafU | - |
| N0499_RS17585 (3591468) | 3591468..3593180 | + | 1713 | Protein_3436 | flagellar biosynthesis protein FlhA | - |
| N0499_RS17590 (3593404) | 3593404..3593901 | - | 498 | WP_000006255.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15487.84 Da Isoelectric Point: 7.4215
>T257635 WP_001263489.1 NZ_CP104328:c3589237-3588839 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A090J8B1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1QAE3 |