Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 717527..718220 | Replicon | chromosome |
Accession | NZ_CP104328 | ||
Organism | Escherichia coli strain THB42-F2 |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | S1EZG2 |
Locus tag | N0499_RS03495 | Protein ID | WP_000415584.1 |
Coordinates | 717527..717823 (+) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | S1EBV2 |
Locus tag | N0499_RS03500 | Protein ID | WP_000650107.1 |
Coordinates | 717825..718220 (+) | Length | 132 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N0499_RS03460 (712615) | 712615..712929 | - | 315 | WP_000958598.1 | putative quinol monooxygenase | - |
N0499_RS03465 (712960) | 712960..713541 | - | 582 | WP_000065430.1 | NADPH:quinone oxidoreductase MdaB | - |
N0499_RS03470 (713860) | 713860..714192 | + | 333 | WP_000917684.1 | DUF2645 family protein | - |
N0499_RS03475 (714238) | 714238..715587 | - | 1350 | WP_000673402.1 | quorum sensing histidine kinase QseC | - |
N0499_RS03480 (715584) | 715584..716243 | - | 660 | WP_001221495.1 | quorum sensing response regulator transcription factor QseB | - |
N0499_RS03485 (716395) | 716395..716787 | + | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
N0499_RS03490 (716840) | 716840..717322 | + | 483 | WP_000183505.1 | GyrI-like domain-containing protein | - |
N0499_RS03495 (717527) | 717527..717823 | + | 297 | WP_000415584.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
N0499_RS03500 (717825) | 717825..718220 | + | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
N0499_RS03505 (718353) | 718353..719960 | + | 1608 | WP_001295629.1 | ABC transporter substrate-binding protein | - |
N0499_RS03510 (720098) | 720098..722356 | + | 2259 | WP_001281881.1 | DNA topoisomerase IV subunit A | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11231.96 Da Isoelectric Point: 8.9070
>T257619 WP_000415584.1 NZ_CP104328:717527-717823 [Escherichia coli]
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT257619 WP_000650107.1 NZ_CP104328:717825-718220 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|