Detailed information of TA system TA257614

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 122855..123124
• Replicon: plasmid pHB42-F1
• Accession: NZ_CP104327
• Organism: Escherichia coli strain THB42-F1

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: N0470_RS23265
• Protein ID: WP_001372321.1
• Coordinates: 122999..123124 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	122855..122920 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
N0470_RS23225	117857..118318	-	462	Protein_129	hypothetical protein	-
N0470_RS23230	118620..119147	+	528	WP_000290834.1	single-stranded DNA-binding protein	-
N0470_RS23235	119205..119438	+	234	WP_000006003.1	DUF905 family protein	-
N0470_RS23240	119499..121467	+	1969	Protein_132	ParB/RepB/Spo0J family partition protein	-
N0470_RS23245	121536..121970	+	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
N0470_RS23250	121967..122729	+	763	Protein_134	plasmid SOS inhibition protein A	-
-	122698..122922	+	225	NuclAT_0	-	-
-	122698..122922	+	225	NuclAT_0	-	-
-	122698..122922	+	225	NuclAT_0	-	-
-	122698..122922	+	225	NuclAT_0	-	-
N0470_RS23255	122707..122886	-	180	WP_001309233.1	hypothetical protein	-
-	122855..122920	-	66	-	-	Antitoxin
N0470_RS23260	122908..123057	+	150	Protein_136	plasmid maintenance protein Mok	-
N0470_RS23265	122999..123124	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
N0470_RS23270	123443..123739	-	297	Protein_138	hypothetical protein	-
N0470_RS23275	124039..124335	+	297	WP_001272251.1	hypothetical protein	-
N0470_RS23280	124446..125267	+	822	WP_001234445.1	DUF932 domain-containing protein	-
N0470_RS23285	125564..126211	-	648	WP_015059008.1	transglycosylase SLT domain-containing protein	-
N0470_RS23290	126488..126871	+	384	WP_000124981.1	conjugal transfer relaxosome DNA-binding protein TraM	-
N0470_RS23295	127062..127748	+	687	WP_015059009.1	PAS domain-containing protein	-
N0470_RS23300	127842..128069	+	228	WP_001254386.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	dfrA12 / aadA2 / qacE / mph(A) / blaTEM-1B / aph(3')-IIa / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / floR / rmtB / blaCTX-M-55	-	1..162761	162761

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T257614 WP_001372321.1 NZ_CP104327:122999-123124 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 66 bp

>AT257614 NZ_CP104327:c122920-122855 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Antitoxin