Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 3631961..3632655 | Replicon | chromosome |
Accession | NZ_CP104326 | ||
Organism | Escherichia coli strain THB42-F1 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | Q47157 |
Locus tag | N0470_RS17790 | Protein ID | WP_001263489.1 |
Coordinates | 3631961..3632359 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | S1QAE3 |
Locus tag | N0470_RS17795 | Protein ID | WP_000554758.1 |
Coordinates | 3632362..3632655 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
- (3627549) | 3627549..3627629 | - | 81 | NuclAT_12 | - | - |
- (3627549) | 3627549..3627629 | - | 81 | NuclAT_12 | - | - |
- (3627549) | 3627549..3627629 | - | 81 | NuclAT_12 | - | - |
- (3627549) | 3627549..3627629 | - | 81 | NuclAT_12 | - | - |
N0470_RS17765 (3628225) | 3628225..3628683 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
N0470_RS17770 (3628944) | 3628944..3630401 | + | 1458 | WP_001292994.1 | cytosol nonspecific dipeptidase | - |
N0470_RS17775 (3630458) | 3630458..3630979 | - | 522 | Protein_3474 | peptide chain release factor H | - |
N0470_RS17780 (3630975) | 3630975..3631181 | - | 207 | Protein_3475 | RtcB family protein | - |
N0470_RS17785 (3631499) | 3631499..3631951 | - | 453 | WP_001059892.1 | GNAT family N-acetyltransferase | - |
N0470_RS17790 (3631961) | 3631961..3632359 | - | 399 | WP_001263489.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
N0470_RS17795 (3632362) | 3632362..3632655 | - | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
N0470_RS17800 (3632707) | 3632707..3633762 | - | 1056 | WP_001226164.1 | DNA polymerase IV | - |
N0470_RS17805 (3633833) | 3633833..3634618 | - | 786 | WP_000207552.1 | putative lateral flagellar export/assembly protein LafU | - |
N0470_RS17810 (3634590) | 3634590..3636302 | + | 1713 | Protein_3481 | flagellar biosynthesis protein FlhA | - |
N0470_RS17815 (3636526) | 3636526..3637023 | - | 498 | WP_000006255.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15487.84 Da Isoelectric Point: 7.4215
>T257604 WP_001263489.1 NZ_CP104326:c3632359-3631961 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A090J8B1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1QAE3 |