Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 716546..717239 | Replicon | chromosome |
Accession | NZ_CP104326 | ||
Organism | Escherichia coli strain THB42-F1 |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | S1EZG2 |
Locus tag | N0470_RS03490 | Protein ID | WP_000415584.1 |
Coordinates | 716546..716842 (+) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | S1EBV2 |
Locus tag | N0470_RS03495 | Protein ID | WP_000650107.1 |
Coordinates | 716844..717239 (+) | Length | 132 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N0470_RS03455 (711634) | 711634..711948 | - | 315 | WP_000958598.1 | putative quinol monooxygenase | - |
N0470_RS03460 (711979) | 711979..712560 | - | 582 | WP_000065430.1 | NADPH:quinone oxidoreductase MdaB | - |
N0470_RS03465 (712879) | 712879..713211 | + | 333 | WP_000917684.1 | DUF2645 family protein | - |
N0470_RS03470 (713257) | 713257..714606 | - | 1350 | WP_000673402.1 | quorum sensing histidine kinase QseC | - |
N0470_RS03475 (714603) | 714603..715262 | - | 660 | WP_001221495.1 | quorum sensing response regulator transcription factor QseB | - |
N0470_RS03480 (715414) | 715414..715806 | + | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
N0470_RS03485 (715859) | 715859..716341 | + | 483 | WP_000183505.1 | GyrI-like domain-containing protein | - |
N0470_RS03490 (716546) | 716546..716842 | + | 297 | WP_000415584.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
N0470_RS03495 (716844) | 716844..717239 | + | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
N0470_RS03500 (717372) | 717372..718979 | + | 1608 | WP_001295629.1 | ABC transporter substrate-binding protein | - |
N0470_RS03505 (719117) | 719117..721375 | + | 2259 | WP_001281881.1 | DNA topoisomerase IV subunit A | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11231.96 Da Isoelectric Point: 8.9070
>T257588 WP_000415584.1 NZ_CP104326:716546-716842 [Escherichia coli]
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT257588 WP_000650107.1 NZ_CP104326:716844-717239 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|