Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 176850..177577 | Replicon | plasmid pKP81324 |
| Accession | NZ_CP104316 | ||
| Organism | Klebsiella pneumoniae strain KP8132 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A7W3D9W1 |
| Locus tag | N2X67_RS29025 | Protein ID | WP_011251285.1 |
| Coordinates | 177266..177577 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | N2X67_RS29020 | Protein ID | WP_011251286.1 |
| Coordinates | 176850..177269 (-) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N2X67_RS28990 (N2X67_28990) | 172018..172488 | - | 471 | WP_048333570.1 | hypothetical protein | - |
| N2X67_RS28995 (N2X67_28995) | 172801..173436 | - | 636 | WP_223171879.1 | hypothetical protein | - |
| N2X67_RS29000 (N2X67_29000) | 173855..174475 | + | 621 | WP_223175004.1 | conjugative transfer protein MobI(A/C) | - |
| N2X67_RS29005 (N2X67_29005) | 174496..175284 | + | 789 | WP_040217257.1 | hypothetical protein | - |
| N2X67_RS29010 (N2X67_29010) | 175298..175663 | + | 366 | WP_048333448.1 | hypothetical protein | - |
| N2X67_RS29015 (N2X67_29015) | 175735..176703 | - | 969 | WP_074428168.1 | IS5 family transposase | - |
| N2X67_RS29020 (N2X67_29020) | 176850..177269 | - | 420 | WP_011251286.1 | helix-turn-helix domain-containing protein | Antitoxin |
| N2X67_RS29025 (N2X67_29025) | 177266..177577 | - | 312 | WP_011251285.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| N2X67_RS29030 (N2X67_29030) | 177782..178219 | - | 438 | Protein_204 | DDE-type integrase/transposase/recombinase | - |
| N2X67_RS29035 (N2X67_29035) | 178354..179051 | + | 698 | WP_223175001.1 | IS1-like element IS1A family transposase | - |
| N2X67_RS29040 (N2X67_29040) | 180437..181087 | - | 651 | WP_068893702.1 | DUF1173 family protein | - |
| N2X67_RS29045 (N2X67_29045) | 181120..181386 | - | 267 | WP_223175074.1 | DUF1173 family protein | - |
| N2X67_RS29050 (N2X67_29050) | 181564..182058 | + | 495 | WP_004212794.1 | thermonuclease family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | - | rmpA / iutA / iutA / iucD / iucC / iucB / iucA / iroN | 1..194876 | 194876 | |
| - | inside | IScluster/Tn | - | - | 169010..194355 | 25345 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12346.12 Da Isoelectric Point: 9.7248
>T257581 WP_011251285.1 NZ_CP104316:c177577-177266 [Klebsiella pneumoniae]
MHVISKEPFEEAAKRYPNDSLAIRALYRLVRETDFSSPAEMLTLIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFVNKRF
YVKHIATHADYDKLTRYYRENKE
MHVISKEPFEEAAKRYPNDSLAIRALYRLVRETDFSSPAEMLTLIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFVNKRF
YVKHIATHADYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15377.46 Da Isoelectric Point: 4.4420
>AT257581 WP_011251286.1 NZ_CP104316:c177269-176850 [Klebsiella pneumoniae]
MITDTAKAIEATKQLVAAVPFLGGSSSESDYREAMELVDYLIENDDENPLIDFLASKIADYEDNSPRFAEFNKAIAEIPV
GVALLRTLIDQHKLSYSDLKDEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL
MITDTAKAIEATKQLVAAVPFLGGSSSESDYREAMELVDYLIENDDENPLIDFLASKIADYEDNSPRFAEFNKAIAEIPV
GVALLRTLIDQHKLSYSDLKDEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|