Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 101829..102082 | Replicon | plasmid pKP81323 |
| Accession | NZ_CP104315 | ||
| Organism | Klebsiella pneumoniae strain KP8132 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | N2X67_RS27780 | Protein ID | WP_001312851.1 |
| Coordinates | 101933..102082 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 101829..101888 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N2X67_RS27740 (97211) | 97211..97555 | - | 345 | Protein_121 | IS6-like element IS26 family transposase | - |
| N2X67_RS27745 (97607) | 97607..98311 | - | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| N2X67_RS27750 (98336) | 98336..98536 | + | 201 | WP_072354025.1 | hypothetical protein | - |
| N2X67_RS27755 (98556) | 98556..99302 | + | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
| N2X67_RS27760 (99357) | 99357..99917 | + | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
| N2X67_RS27765 (100049) | 100049..100249 | + | 201 | WP_015059022.1 | hypothetical protein | - |
| N2X67_RS27770 (100635) | 100635..101234 | + | 600 | WP_032083981.1 | PIN domain-containing protein | - |
| N2X67_RS27775 (101296) | 101296..101628 | + | 333 | WP_152916585.1 | hypothetical protein | - |
| - (101829) | 101829..101888 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (101829) | 101829..101888 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (101829) | 101829..101888 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (101829) | 101829..101888 | - | 60 | NuclAT_1 | - | Antitoxin |
| N2X67_RS27780 (101933) | 101933..102082 | + | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| N2X67_RS27785 (102366) | 102366..102614 | + | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
| N2X67_RS27790 (102729) | 102729..102907 | + | 179 | Protein_131 | protein CopA/IncA | - |
| N2X67_RS27795 (102926) | 102926..103782 | + | 857 | Protein_132 | incFII family plasmid replication initiator RepA | - |
| N2X67_RS27800 (104721) | 104721..105374 | + | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| N2X67_RS27805 (105467) | 105467..105724 | + | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| N2X67_RS27810 (105657) | 105657..106058 | + | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| N2X67_RS27815 (106307) | 106307..106722 | + | 416 | Protein_136 | IS1 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | blaSHV-12 / blaKPC-2 / blaCTX-M-65 / blaTEM-1B / rmtB | - | 1..135468 | 135468 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T257575 WP_001312851.1 NZ_CP104315:101933-102082 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 60 bp
>AT257575 NZ_CP104315:c101888-101829 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
