Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 2502..2771 | Replicon | plasmid pKP81323 |
Accession | NZ_CP104315 | ||
Organism | Klebsiella pneumoniae strain KP8132 |
Toxin (Protein)
Gene name | hok | Uniprot ID | G9G195 |
Locus tag | N2X67_RS27160 | Protein ID | WP_001323520.1 |
Coordinates | 2655..2771 (+) | Length | 39 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 2502..2567 (-) |
Genomic Context
Location: 707..1114 (408 bp)
Type: Others
Protein ID: WP_228706454.1
Type: Others
Protein ID: WP_228706454.1
Location: 1183..1617 (435 bp)
Type: Others
Protein ID: WP_000845953.1
Type: Others
Protein ID: WP_000845953.1
Location: 1614..2333 (720 bp)
Type: Others
Protein ID: WP_001276217.1
Type: Others
Protein ID: WP_001276217.1
Location: 2345..2569 (225 bp)
Type: Others
Protein ID: NuclAT_0
Type: Others
Protein ID: NuclAT_0
Location: 2345..2569 (225 bp)
Type: Others
Protein ID: NuclAT_0
Type: Others
Protein ID: NuclAT_0
Location: 2345..2569 (225 bp)
Type: Others
Protein ID: NuclAT_0
Type: Others
Protein ID: NuclAT_0
Location: 2345..2569 (225 bp)
Type: Others
Protein ID: NuclAT_0
Type: Others
Protein ID: NuclAT_0
Location: 2555..2704 (150 bp)
Type: Others
Protein ID: Protein_4
Type: Others
Protein ID: Protein_4
Location: 2655..2771 (117 bp)
Type: Toxin
Protein ID: WP_001323520.1
Type: Toxin
Protein ID: WP_001323520.1
Location: 3685..3981 (297 bp)
Type: Others
Protein ID: WP_001272251.1
Type: Others
Protein ID: WP_001272251.1
Location: 4092..4913 (822 bp)
Type: Others
Protein ID: WP_001234445.1
Type: Others
Protein ID: WP_001234445.1
Location: 6134..6517 (384 bp)
Type: Others
Protein ID: WP_000124981.1
Type: Others
Protein ID: WP_000124981.1
Location: 6798..7502 (705 bp)
Type: Others
Protein ID: WP_001067855.1
Type: Others
Protein ID: WP_001067855.1
Location: 2502..2567 (66 bp)
Type: Antitoxin
Protein ID: -
Type: Antitoxin
Protein ID: -
Location: 3090..3386 (297 bp)
Type: Others
Protein ID: Protein_6
Type: Others
Protein ID: Protein_6
Location: 5210..5857 (648 bp)
Type: Others
Protein ID: WP_015059008.1
Type: Others
Protein ID: WP_015059008.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N2X67_RS27140 | 707..1114 | + | 408 | WP_228706454.1 | hypothetical protein | - |
N2X67_RS27145 | 1183..1617 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
N2X67_RS27150 | 1614..2333 | + | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
- | 2345..2569 | + | 225 | NuclAT_0 | - | - |
- | 2345..2569 | + | 225 | NuclAT_0 | - | - |
- | 2345..2569 | + | 225 | NuclAT_0 | - | - |
- | 2345..2569 | + | 225 | NuclAT_0 | - | - |
- | 2502..2567 | - | 66 | - | - | Antitoxin |
N2X67_RS27155 | 2555..2704 | + | 150 | Protein_4 | plasmid maintenance protein Mok | - |
N2X67_RS27160 | 2655..2771 | + | 117 | WP_001323520.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
N2X67_RS27165 | 3090..3386 | - | 297 | Protein_6 | hypothetical protein | - |
N2X67_RS27170 | 3685..3981 | + | 297 | WP_001272251.1 | hypothetical protein | - |
N2X67_RS27175 | 4092..4913 | + | 822 | WP_001234445.1 | DUF932 domain-containing protein | - |
N2X67_RS27180 | 5210..5857 | - | 648 | WP_015059008.1 | transglycosylase SLT domain-containing protein | - |
N2X67_RS27185 | 6134..6517 | + | 384 | WP_000124981.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
N2X67_RS27190 | 6798..7502 | + | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | blaSHV-12 / blaKPC-2 / blaCTX-M-65 / blaTEM-1B / rmtB | - | 1..135468 | 135468 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 39 a.a. Molecular weight: 4455.23 Da Isoelectric Point: 8.5110
>T257573 WP_001323520.1 NZ_CP104315:2655-2771 [Klebsiella pneumoniae]
VCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 117 bp
Antitoxin
Download Length: 66 bp
>AT257573 NZ_CP104315:c2567-2502 [Klebsiella pneumoniae]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | G9G195 |