Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | symE-agrB/SymE(toxin) |
| Location | 4713439..4713851 | Replicon | chromosome |
| Accession | NZ_CP104309 | ||
| Organism | Escherichia coli O157:H7 strain 380-94 | ||
Toxin (Protein)
| Gene name | symE | Uniprot ID | Q8FA88 |
| Locus tag | NUE46_RS23785 | Protein ID | WP_000132630.1 |
| Coordinates | 4713510..4713851 (+) | Length | 114 a.a. |
Antitoxin (RNA)
| Gene name | agrB | ||
| Locus tag | - | ||
| Coordinates | 4713439..4713515 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NUE46_RS23775 (4710066) | 4710066..4711535 | + | 1470 | WP_001302468.1 | type I restriction-modification system subunit M | - |
| NUE46_RS23780 (4711535) | 4711535..4713289 | + | 1755 | WP_000110082.1 | restriction endonuclease subunit S | - |
| - (4713439) | 4713439..4713515 | - | 77 | NuclAT_15 | - | Antitoxin |
| - (4713439) | 4713439..4713515 | - | 77 | NuclAT_15 | - | Antitoxin |
| - (4713439) | 4713439..4713515 | - | 77 | NuclAT_15 | - | Antitoxin |
| - (4713439) | 4713439..4713515 | - | 77 | NuclAT_15 | - | Antitoxin |
| - (4713439) | 4713439..4713515 | - | 77 | NuclAT_16 | - | Antitoxin |
| - (4713439) | 4713439..4713515 | - | 77 | NuclAT_16 | - | Antitoxin |
| - (4713439) | 4713439..4713515 | - | 77 | NuclAT_16 | - | Antitoxin |
| - (4713439) | 4713439..4713515 | - | 77 | NuclAT_16 | - | Antitoxin |
| NUE46_RS23785 (4713510) | 4713510..4713851 | + | 342 | WP_000132630.1 | endoribonuclease SymE | Toxin |
| NUE46_RS23790 (4713898) | 4713898..4715061 | - | 1164 | WP_001304006.1 | DUF1524 domain-containing protein | - |
| NUE46_RS23795 (4715109) | 4715109..4715990 | - | 882 | WP_001304007.1 | DUF262 domain-containing protein | - |
| NUE46_RS23800 (4716133) | 4716133..4716285 | - | 153 | WP_001418365.1 | hypothetical protein | - |
| NUE46_RS23805 (4716428) | 4716428..4717840 | + | 1413 | WP_000199295.1 | PLP-dependent aminotransferase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Genomic island | - | espX6 | 4705638..4726871 | 21233 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12294.13 Da Isoelectric Point: 8.4982
>T257550 WP_000132630.1 NZ_CP104309:4713510-4713851 [Escherichia coli O157:H7]
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTVVDVKVMEGCIVLTAQPPAAAESE
LMQSLRQVCKLSARKQRQVQEFIGVIAGKQKVA
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTVVDVKVMEGCIVLTAQPPAAAESE
LMQSLRQVCKLSARKQRQVQEFIGVIAGKQKVA
Download Length: 342 bp
Antitoxin
Download Length: 77 bp
>AT257550 NZ_CP104309:c4713515-4713439 [Escherichia coli O157:H7]
AGTCATAACTGCTATTCCCTATAAATAGTGATTGTGATTAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
AGTCATAACTGCTATTCCCTATAAATAGTGATTGTGATTAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|