Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 4362099..4362793 | Replicon | chromosome |
| Accession | NZ_CP104309 | ||
| Organism | Escherichia coli O157:H7 strain 380-94 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | C3TNX7 |
| Locus tag | NUE46_RS22175 | Protein ID | WP_001263495.1 |
| Coordinates | 4362099..4362497 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | S1FJN6 |
| Locus tag | NUE46_RS22180 | Protein ID | WP_000554757.1 |
| Coordinates | 4362500..4362793 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| - (4357686) | 4357686..4357766 | - | 81 | NuclAT_12 | - | - |
| - (4357686) | 4357686..4357766 | - | 81 | NuclAT_12 | - | - |
| - (4357686) | 4357686..4357766 | - | 81 | NuclAT_12 | - | - |
| - (4357686) | 4357686..4357766 | - | 81 | NuclAT_12 | - | - |
| NUE46_RS22150 (4358362) | 4358362..4358820 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
| NUE46_RS22155 (4359081) | 4359081..4360538 | + | 1458 | WP_001293009.1 | cytosol nonspecific dipeptidase | - |
| NUE46_RS22160 (4360595) | 4360595..4361116 | - | 522 | Protein_4341 | peptide chain release factor H | - |
| NUE46_RS22165 (4361115) | 4361115..4361318 | - | 204 | Protein_4342 | RtcB family protein | - |
| NUE46_RS22170 (4361637) | 4361637..4362089 | - | 453 | WP_001059871.1 | GNAT family N-acetyltransferase | - |
| NUE46_RS22175 (4362099) | 4362099..4362497 | - | 399 | WP_001263495.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| NUE46_RS22180 (4362500) | 4362500..4362793 | - | 294 | WP_000554757.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| NUE46_RS22185 (4362845) | 4362845..4363900 | - | 1056 | WP_001226188.1 | DNA polymerase IV | - |
| NUE46_RS22190 (4363971) | 4363971..4364756 | - | 786 | WP_000207556.1 | putative lateral flagellar export/assembly protein LafU | - |
| NUE46_RS22195 (4364728) | 4364728..4366440 | + | 1713 | Protein_4348 | flagellar biosynthesis protein FlhA | - |
| NUE46_RS22200 (4366585) | 4366585..4367082 | - | 498 | Protein_4349 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15473.86 Da Isoelectric Point: 8.0949
>T257548 WP_001263495.1 NZ_CP104309:c4362497-4362099 [Escherichia coli O157:H7]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDESHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDESHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|