Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 3157713..3158508 Replicon chromosome
Accession NZ_CP104309
Organism Escherichia coli O157:H7 strain 380-94

Toxin (Protein)


Gene name yeeV Uniprot ID B7UP43
Locus tag NUE46_RS16125 Protein ID WP_000854914.1
Coordinates 3157713..3158087 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A0B0VS41
Locus tag NUE46_RS16130 Protein ID WP_001280954.1
Coordinates 3158134..3158508 (-) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NUE46_RS16085 (3152717) 3152717..3153208 - 492 WP_001301587.1 DUF1097 domain-containing protein -
NUE46_RS16090 (3153310) 3153310..3153864 - 555 WP_001001917.1 molecular chaperone YcdY -
NUE46_RS16095 (3153888) 3153888..3154625 - 738 WP_000283664.1 zinc-binding phosphatase -
NUE46_RS16100 (3154680) 3154680..3155618 - 939 WP_000351284.1 glyoxylate/hydroxypyruvate reductase GhrA -
NUE46_RS16110 (3156089) 3156089..3156931 - 843 WP_001280481.1 DUF4942 domain-containing protein -
NUE46_RS16115 (3157016) 3157016..3157213 - 198 WP_000839282.1 DUF957 domain-containing protein -
NUE46_RS16120 (3157225) 3157225..3157716 - 492 WP_000976853.1 DUF5983 family protein -
NUE46_RS16125 (3157713) 3157713..3158087 - 375 WP_000854914.1 TA system toxin CbtA family protein Toxin
NUE46_RS16130 (3158134) 3158134..3158508 - 375 WP_001280954.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
NUE46_RS16135 (3158671) 3158671..3158892 - 222 WP_001220314.1 DUF987 domain-containing protein -
NUE46_RS16140 (3158955) 3158955..3159431 - 477 WP_001186738.1 RadC family protein -
NUE46_RS16145 (3159447) 3159447..3159932 - 486 WP_000214398.1 antirestriction protein -
NUE46_RS16150 (3160023) 3160023..3160841 - 819 WP_001234682.1 DUF932 domain-containing protein -
NUE46_RS16155 (3161181) 3161181..3162251 - 1071 WP_000102669.1 patatin-like phospholipase family protein -
NUE46_RS16160 (3162248) 3162248..3163153 - 906 WP_000203541.1 diguanylate cyclase regulator RdcB family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Genomic island - csgB / csgD / csgE / csgF / csgG 3149099..3159932 10833


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 14117.17 Da        Isoelectric Point: 7.7761

>T257544 WP_000854914.1 NZ_CP104309:c3158087-3157713 [Escherichia coli O157:H7]
MKTLSDTHVREVSRCPSPVTIWQTLLIRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 13718.51 Da        Isoelectric Point: 6.6249

>AT257544 WP_001280954.1 NZ_CP104309:c3158508-3158134 [Escherichia coli O157:H7]
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRYQHTVTLNAKGLTCEADTLGSCGYVYLAVYPTPAPATTS

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LXR5

Antitoxin

Source ID Structure
AlphaFold DB A0A0B0VS41

References