Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | paaR-paaA-parE/- |
Location | 2417602..2418073 | Replicon | chromosome |
Accession | NZ_CP104309 | ||
Organism | Escherichia coli O157:H7 strain 380-94 |
Toxin (Protein)
Gene name | parE_1 | Uniprot ID | A0A0D7C2L1 |
Locus tag | NUE46_RS12060 | Protein ID | WP_001303511.1 |
Coordinates | 2417602..2417880 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | paaA | Uniprot ID | Q8XAD5 |
Locus tag | NUE46_RS12065 | Protein ID | WP_001302048.1 |
Coordinates | 2417882..2418073 (-) | Length | 64 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NUE46_RS12030 (2412827) | 2412827..2413078 | - | 252 | WP_000005552.1 | excisionase family protein | - |
NUE46_RS12035 (2413151) | 2413151..2415622 | - | 2472 | WP_000048458.1 | exonuclease | - |
NUE46_RS12040 (2415715) | 2415715..2415906 | - | 192 | WP_001090200.1 | DUF1482 family protein | - |
NUE46_RS12045 (2415903) | 2415903..2416091 | - | 189 | WP_000449192.1 | cell division inhibition protein DicB | - |
NUE46_RS12050 (2416660) | 2416660..2416878 | - | 219 | WP_001171930.1 | protein YdfC | - |
NUE46_RS12055 (2416950) | 2416950..2417249 | - | 300 | WP_001240334.1 | hypothetical protein | - |
NUE46_RS12060 (2417602) | 2417602..2417880 | - | 279 | WP_001303511.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NUE46_RS12065 (2417882) | 2417882..2418073 | - | 192 | WP_001302048.1 | hypothetical protein | Antitoxin |
NUE46_RS12070 (2418094) | 2418094..2418465 | - | 372 | WP_001169686.1 | hypothetical protein | - |
NUE46_RS12075 (2418563) | 2418563..2418865 | + | 303 | WP_000172738.1 | transcriptional regulator | - |
NUE46_RS12080 (2418862) | 2418862..2419287 | + | 426 | WP_000693943.1 | toxin YdaT family protein | - |
NUE46_RS12085 (2419310) | 2419310..2420272 | + | 963 | WP_000095669.1 | helix-turn-helix domain-containing protein | - |
NUE46_RS12090 (2420279) | 2420279..2421019 | + | 741 | WP_000788938.1 | ATP-binding protein | - |
NUE46_RS12095 (2421045) | 2421045..2421814 | + | 770 | Protein_2366 | DUF1627 domain-containing protein | - |
NUE46_RS12100 (2421830) | 2421830..2422225 | + | 396 | WP_001118159.1 | DUF977 family protein | - |
NUE46_RS12105 (2422282) | 2422282..2422866 | + | 585 | WP_000206793.1 | DUF551 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 2402722..2455433 | 52711 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10661.25 Da Isoelectric Point: 5.5647
>T257539 WP_001303511.1 NZ_CP104309:c2417880-2417602 [Escherichia coli O157:H7]
MLPVLWLESADTDLDDITSYIARFDIDAAERLWQRLRGCVLPLSEHPYLYPPSDRVPGLREIVAHPNYIILYRVTTSSVE
VVNVIHARRQFP
MLPVLWLESADTDLDDITSYIARFDIDAAERLWQRLRGCVLPLSEHPYLYPPSDRVPGLREIVAHPNYIILYRVTTSSVE
VVNVIHARRQFP
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|