Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | DinJ-YafQ (relBE)/YafQ-DinJ |
Location | 1805278..1805842 | Replicon | chromosome |
Accession | NZ_CP104303 | ||
Organism | Lacticaseibacillus paracasei strain VHProbi O44 |
Toxin (Protein)
Gene name | yafQ | Uniprot ID | A0A510WIJ9 |
Locus tag | N4T21_RS08810 | Protein ID | WP_016363448.1 |
Coordinates | 1805278..1805580 (-) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | dinJ | Uniprot ID | K6SLT0 |
Locus tag | N4T21_RS08815 | Protein ID | WP_003570051.1 |
Coordinates | 1805573..1805842 (-) | Length | 90 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4T21_RS08790 (N4T21_08790) | 1800591..1801148 | + | 558 | WP_260642700.1 | helix-turn-helix transcriptional regulator | - |
N4T21_RS08795 (N4T21_08795) | 1801573..1803750 | - | 2178 | WP_260642701.1 | Tex family protein | - |
N4T21_RS08800 (N4T21_08800) | 1803986..1804678 | - | 693 | WP_003570055.1 | hypothetical protein | - |
N4T21_RS08805 (N4T21_08805) | 1804796..1804939 | - | 144 | WP_162259784.1 | hypothetical protein | - |
N4T21_RS08810 (N4T21_08810) | 1805278..1805580 | - | 303 | WP_016363448.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
N4T21_RS08815 (N4T21_08815) | 1805573..1805842 | - | 270 | WP_003570051.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
N4T21_RS08820 (N4T21_08820) | 1806216..1806869 | - | 654 | WP_003570049.1 | N-acetyltransferase | - |
N4T21_RS08825 (N4T21_08825) | 1806914..1807543 | - | 630 | WP_003570047.1 | DUF2399 domain-containing protein | - |
N4T21_RS08830 (N4T21_08830) | 1807606..1807932 | - | 327 | WP_003584272.1 | YrdB family protein | - |
N4T21_RS08835 (N4T21_08835) | 1807925..1808329 | - | 405 | WP_003570045.1 | MerR family transcriptional regulator | - |
N4T21_RS08840 (N4T21_08840) | 1808527..1809753 | + | 1227 | WP_003570043.1 | hypothetical protein | - |
N4T21_RS08845 (N4T21_08845) | 1809950..1810837 | + | 888 | WP_003570041.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11510.33 Da Isoelectric Point: 9.8881
>T257525 WP_016363448.1 NZ_CP104303:c1805580-1805278 [Lacticaseibacillus paracasei]
MYSLVPTPTFKRDLKRLSKKHWPMDELKTAVNLLAAGTNAELLSKKYADHALSSSSEWKGYRELYVDGPRGDWLLIYKIE
QQDLILTLVRTGSHHNLLVK
MYSLVPTPTFKRDLKRLSKKHWPMDELKTAVNLLAAGTNAELLSKKYADHALSSSSEWKGYRELYVDGPRGDWLLIYKIE
QQDLILTLVRTGSHHNLLVK
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A510WIJ9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E2BRK6 |