257524

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) DinJ-YafQ (relBE)/YafQ-RelB
Location 622553..623069 Replicon chromosome
Accession NZ_CP104303
Organism Lacticaseibacillus paracasei strain VHProbi O44

Toxin (Protein)


Gene name yafQ Uniprot ID -
Locus tag N4T21_RS03030 Protein ID WP_260643018.1
Coordinates 622553..622834 (-) Length 94 a.a.

Antitoxin (Protein)


Gene name dinJ Uniprot ID -
Locus tag N4T21_RS03035 Protein ID WP_260643019.1
Coordinates 622827..623069 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N4T21_RS02995 (N4T21_02995) 618193..619050 + 858 WP_003569650.1 sugar ABC transporter permease -
N4T21_RS03000 (N4T21_03000) 619234..620190 + 957 WP_003569652.1 LacI family DNA-binding transcriptional regulator -
N4T21_RS03005 (N4T21_03005) 620249..620380 - 132 Protein_596 helix-turn-helix domain-containing protein -
N4T21_RS03010 (N4T21_03010) 620772..621056 - 285 WP_016383626.1 BRCT domain-containing protein -
N4T21_RS03015 (N4T21_03015) 621062..621712 - 651 WP_003586220.1 recombinase family protein -
N4T21_RS03020 (N4T21_03020) 621849..622130 - 282 WP_003573774.1 type II toxin-antitoxin system YafQ family toxin -
N4T21_RS03025 (N4T21_03025) 622123..622365 - 243 WP_016363783.1 type II toxin-antitoxin system RelB/DinJ family antitoxin -
N4T21_RS03030 (N4T21_03030) 622553..622834 - 282 WP_260643018.1 type II toxin-antitoxin system YafQ family toxin Toxin
N4T21_RS03035 (N4T21_03035) 622827..623069 - 243 WP_260643019.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
N4T21_RS03040 (N4T21_03040) 623196..623564 - 369 WP_003582572.1 YxeA family protein -
N4T21_RS03045 (N4T21_03045) 623859..624209 - 351 WP_003582569.1 hypothetical protein -
N4T21_RS03050 (N4T21_03050) 624373..624462 + 90 Protein_605 IS30 family transposase -
N4T21_RS03055 (N4T21_03055) 624504..624971 - 468 WP_003582565.1 DNA starvation/stationary phase protection protein -
N4T21_RS03060 (N4T21_03060) 625481..626359 + 879 WP_257710654.1 IS3 family transposase -
N4T21_RS03065 (N4T21_03065) 626587..627147 + 561 WP_016374492.1 hypothetical protein -
N4T21_RS03070 (N4T21_03070) 627411..627536 + 126 WP_016374491.1 IS3 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 556816..659426 102610
- flank IS/Tn - - 627411..627536 125


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, YafQ-like toxin

(9-92)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(3-63)


Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 11372.92 Da        Isoelectric Point: 8.4074

>T257524 WP_260643018.1 NZ_CP104303:c622834-622553 [Lacticaseibacillus paracasei]
MNKFVYKPAFERQFKEHYKTILKGGRYKKEDFEAVYHKLLRDEPLDPHYNDHALVNRKPERDLHIKPDWLLIYKYDGEFV
RFIDTGSHSDLFN

Download         Length: 282 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9217.40 Da        Isoelectric Point: 4.8356

>AT257524 WP_260643019.1 NZ_CP104303:c623069-622827 [Lacticaseibacillus paracasei]
MTSQVHFRMSEKEKKDFEIVLSRVGLTPGEAFRIFAKKSIEAGGIPFEVSQPNTRLQKAIRSQDYVEFNDPEEGLDWLNE

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References