Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | DinJ-YafQ (relBE)/YafQ-RelB |
| Location | 621849..622365 | Replicon | chromosome |
| Accession | NZ_CP104303 | ||
| Organism | Lacticaseibacillus paracasei strain VHProbi O44 | ||
Toxin (Protein)
| Gene name | yafQ | Uniprot ID | A0A243Q0H7 |
| Locus tag | N4T21_RS03020 | Protein ID | WP_003573774.1 |
| Coordinates | 621849..622130 (-) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | dinJ | Uniprot ID | - |
| Locus tag | N4T21_RS03025 | Protein ID | WP_016363783.1 |
| Coordinates | 622123..622365 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4T21_RS02995 (N4T21_02995) | 618193..619050 | + | 858 | WP_003569650.1 | sugar ABC transporter permease | - |
| N4T21_RS03000 (N4T21_03000) | 619234..620190 | + | 957 | WP_003569652.1 | LacI family DNA-binding transcriptional regulator | - |
| N4T21_RS03005 (N4T21_03005) | 620249..620380 | - | 132 | Protein_596 | helix-turn-helix domain-containing protein | - |
| N4T21_RS03010 (N4T21_03010) | 620772..621056 | - | 285 | WP_016383626.1 | BRCT domain-containing protein | - |
| N4T21_RS03015 (N4T21_03015) | 621062..621712 | - | 651 | WP_003586220.1 | recombinase family protein | - |
| N4T21_RS03020 (N4T21_03020) | 621849..622130 | - | 282 | WP_003573774.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
| N4T21_RS03025 (N4T21_03025) | 622123..622365 | - | 243 | WP_016363783.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| N4T21_RS03030 (N4T21_03030) | 622553..622834 | - | 282 | WP_260643018.1 | type II toxin-antitoxin system YafQ family toxin | - |
| N4T21_RS03035 (N4T21_03035) | 622827..623069 | - | 243 | WP_260643019.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
| N4T21_RS03040 (N4T21_03040) | 623196..623564 | - | 369 | WP_003582572.1 | YxeA family protein | - |
| N4T21_RS03045 (N4T21_03045) | 623859..624209 | - | 351 | WP_003582569.1 | hypothetical protein | - |
| N4T21_RS03050 (N4T21_03050) | 624373..624462 | + | 90 | Protein_605 | IS30 family transposase | - |
| N4T21_RS03055 (N4T21_03055) | 624504..624971 | - | 468 | WP_003582565.1 | DNA starvation/stationary phase protection protein | - |
| N4T21_RS03060 (N4T21_03060) | 625481..626359 | + | 879 | WP_257710654.1 | IS3 family transposase | - |
| N4T21_RS03065 (N4T21_03065) | 626587..627147 | + | 561 | WP_016374492.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 556816..659426 | 102610 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 11371.98 Da Isoelectric Point: 9.5081
>T257523 WP_003573774.1 NZ_CP104303:c622130-621849 [Lacticaseibacillus paracasei]
MNKFVYKPAFERQFKKHYKTILKGGRYKKEDFEAVYHKLLRDEPLDPHYNDHALVNRKPERDLHIKPDWLLIYKYDGEFV
RFIDTGSHSDLFN
MNKFVYKPAFERQFKKHYKTILKGGRYKKEDFEAVYHKLLRDEPLDPHYNDHALVNRKPERDLHIKPDWLLIYKYDGEFV
RFIDTGSHSDLFN
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|