Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
| Location | 5243092..5243687 | Replicon | chromosome |
| Accession | NZ_CP104301 | ||
| Organism | Pseudomonas aeruginosa strain PLL01 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | V6ALY3 |
| Locus tag | N4Q74_RS24315 | Protein ID | WP_003113526.1 |
| Coordinates | 5243409..5243687 (-) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | N4Q74_RS24310 | Protein ID | WP_003113527.1 |
| Coordinates | 5243092..5243397 (-) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4Q74_RS24275 | 5238231..5239079 | + | 849 | WP_003099284.1 | 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase | - |
| N4Q74_RS24285 | 5239246..5240187 | + | 942 | WP_003099281.1 | ribose-phosphate pyrophosphokinase | - |
| N4Q74_RS24290 | 5240304..5240918 | + | 615 | WP_003099279.1 | 50S ribosomal protein L25/general stress protein Ctc | - |
| N4Q74_RS24295 | 5240960..5241544 | + | 585 | WP_003099278.1 | aminoacyl-tRNA hydrolase | - |
| N4Q74_RS24300 | 5241585..5242685 | + | 1101 | WP_003099270.1 | redox-regulated ATPase YchF | - |
| N4Q74_RS24310 | 5243092..5243397 | - | 306 | WP_003113527.1 | HigA family addiction module antitoxin | Antitoxin |
| N4Q74_RS24315 | 5243409..5243687 | - | 279 | WP_003113526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| N4Q74_RS24320 | 5243740..5243868 | - | 129 | Protein_4803 | integrase | - |
| N4Q74_RS24325 | 5244016..5246244 | + | 2229 | WP_003113525.1 | TonB-dependent receptor | - |
| N4Q74_RS24330 | 5246314..5246961 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
| N4Q74_RS24335 | 5247023..5248261 | - | 1239 | WP_003113524.1 | dipeptidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10646.19 Da Isoelectric Point: 7.8937
>T257509 WP_003113526.1 NZ_CP104301:c5243687-5243409 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|