Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 26165..26823 | Replicon | plasmid pZHOU-2 |
| Accession | NZ_CP104299 | ||
| Organism | Acinetobacter baumannii strain ZHOU | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | N2K92_RS20080 | Protein ID | WP_000312250.1 |
| Coordinates | 26464..26823 (-) | Length | 120 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | N2K92_RS20075 | Protein ID | WP_001096429.1 |
| Coordinates | 26165..26464 (-) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N2K92_RS20040 (N2K92_20055) | 22223..22480 | + | 258 | WP_071210684.1 | hypothetical protein | - |
| N2K92_RS20045 (N2K92_20060) | 22485..23057 | + | 573 | WP_071210685.1 | hypothetical protein | - |
| N2K92_RS20050 (N2K92_20065) | 23033..23212 | + | 180 | WP_002081921.1 | hypothetical protein | - |
| N2K92_RS20055 (N2K92_20070) | 23229..23858 | + | 630 | WP_071210686.1 | hypothetical protein | - |
| N2K92_RS20060 (N2K92_20075) | 23898..24407 | + | 510 | WP_001043200.1 | hypothetical protein | - |
| N2K92_RS20065 (N2K92_20080) | 24488..25042 | + | 555 | WP_071210687.1 | hypothetical protein | - |
| N2K92_RS20070 (N2K92_20085) | 25092..25628 | + | 537 | WP_000731980.1 | hypothetical protein | - |
| N2K92_RS20075 (N2K92_20090) | 26165..26464 | - | 300 | WP_001096429.1 | XRE family transcriptional regulator | Antitoxin |
| N2K92_RS20080 (N2K92_20095) | 26464..26823 | - | 360 | WP_000312250.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| N2K92_RS20085 (N2K92_20100) | 27024..27590 | + | 567 | WP_000710385.1 | hypothetical protein | - |
| N2K92_RS20090 (N2K92_20105) | 27639..27821 | + | 183 | WP_000373385.1 | hypothetical protein | - |
| N2K92_RS20095 (N2K92_20110) | 27888..28586 | + | 699 | WP_000873190.1 | hypothetical protein | - |
| N2K92_RS20100 (N2K92_20115) | 28725..29108 | + | 384 | WP_071210698.1 | hypothetical protein | - |
| N2K92_RS20105 (N2K92_20120) | 29169..29927 | + | 759 | WP_071210697.1 | hypothetical protein | - |
| N2K92_RS20110 (N2K92_20125) | 29978..30313 | + | 336 | WP_071210696.1 | hypothetical protein | - |
| N2K92_RS20115 (N2K92_20130) | 31180..31494 | + | 315 | WP_071210660.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..72233 | 72233 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 120 a.a. Molecular weight: 13751.62 Da Isoelectric Point: 4.8212
>T257503 WP_000312250.1 NZ_CP104299:c26823-26464 [Acinetobacter baumannii]
MAWDVETTELFDSWLAEQDENAQDKILASLLVLSELGPNLGRPHVDTIKESKYPNMKEIRVQVKGHPIRGFFAFDPERKA
IVLCAGDKKGLNEKAFYKEMIKIADEQYEQYLRDNYGDK
MAWDVETTELFDSWLAEQDENAQDKILASLLVLSELGPNLGRPHVDTIKESKYPNMKEIRVQVKGHPIRGFFAFDPERKA
IVLCAGDKKGLNEKAFYKEMIKIADEQYEQYLRDNYGDK
Download Length: 360 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|