Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 26912..27570 | Replicon | plasmid pDETAB-C9-1 |
Accession | NZ_CP104296 | ||
Organism | Acinetobacter baumannii strain DETAB-C9 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | N4Q44_RS19135 | Protein ID | WP_000312250.1 |
Coordinates | 27211..27570 (-) | Length | 120 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | N4Q44_RS19130 | Protein ID | WP_001096429.1 |
Coordinates | 26912..27211 (-) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4Q44_RS19100 (N4Q44_19110) | 22932..23582 | + | 651 | WP_139845924.1 | hypothetical protein | - |
N4Q44_RS19105 (N4Q44_19115) | 23622..24131 | + | 510 | WP_001043199.1 | hypothetical protein | - |
N4Q44_RS19110 (N4Q44_19120) | 24212..24766 | + | 555 | WP_038345807.1 | hypothetical protein | - |
N4Q44_RS19115 (N4Q44_19125) | 24816..25352 | + | 537 | WP_000731981.1 | hypothetical protein | - |
N4Q44_RS19120 (N4Q44_19130) | 25973..26455 | + | 483 | WP_001052677.1 | hypothetical protein | - |
N4Q44_RS19125 (N4Q44_19135) | 26548..26811 | - | 264 | WP_000110863.1 | hypothetical protein | - |
N4Q44_RS19130 (N4Q44_19140) | 26912..27211 | - | 300 | WP_001096429.1 | XRE family transcriptional regulator | Antitoxin |
N4Q44_RS19135 (N4Q44_19145) | 27211..27570 | - | 360 | WP_000312250.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N4Q44_RS19140 (N4Q44_19150) | 27771..28337 | + | 567 | WP_000710385.1 | hypothetical protein | - |
N4Q44_RS19145 (N4Q44_19155) | 28386..28568 | + | 183 | WP_000373385.1 | hypothetical protein | - |
N4Q44_RS19150 (N4Q44_19160) | 28635..29333 | + | 699 | WP_000873188.1 | hypothetical protein | - |
N4Q44_RS19155 (N4Q44_19165) | 29472..29855 | + | 384 | WP_000654348.1 | hypothetical protein | - |
N4Q44_RS19160 (N4Q44_19170) | 29922..30680 | + | 759 | WP_001053128.1 | hypothetical protein | - |
N4Q44_RS19165 (N4Q44_19175) | 30732..31067 | + | 336 | WP_000653925.1 | hypothetical protein | - |
N4Q44_RS19170 (N4Q44_19180) | 31932..32246 | + | 315 | WP_000708715.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..73444 | 73444 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 120 a.a. Molecular weight: 13751.62 Da Isoelectric Point: 4.8212
>T257499 WP_000312250.1 NZ_CP104296:c27570-27211 [Acinetobacter baumannii]
MAWDVETTELFDSWLAEQDENAQDKILASLLVLSELGPNLGRPHVDTIKESKYPNMKEIRVQVKGHPIRGFFAFDPERKA
IVLCAGDKKGLNEKAFYKEMIKIADEQYEQYLRDNYGDK
MAWDVETTELFDSWLAEQDENAQDKILASLLVLSELGPNLGRPHVDTIKESKYPNMKEIRVQVKGHPIRGFFAFDPERKA
IVLCAGDKKGLNEKAFYKEMIKIADEQYEQYLRDNYGDK
Download Length: 360 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|