Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 3558815..3559472 | Replicon | chromosome |
| Accession | NZ_CP104285 | ||
| Organism | Enterobacter mori strain JT.W3M11 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | N2K86_RS16695 | Protein ID | WP_260659333.1 |
| Coordinates | 3558815..3559114 (+) | Length | 100 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | N2K86_RS16700 | Protein ID | WP_260659334.1 |
| Coordinates | 3559125..3559472 (+) | Length | 116 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N2K86_RS16685 (N2K86_16685) | 3555191..3557383 | + | 2193 | WP_260659332.1 | type I secretion system permease/ATPase | - |
| N2K86_RS16690 (N2K86_16690) | 3557394..3558563 | + | 1170 | WP_260661710.1 | HlyD family efflux transporter periplasmic adaptor subunit | - |
| N2K86_RS16695 (N2K86_16695) | 3558815..3559114 | + | 300 | WP_260659333.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| N2K86_RS16700 (N2K86_16700) | 3559125..3559472 | + | 348 | WP_260659334.1 | HigA family addiction module antitoxin | Antitoxin |
| N2K86_RS16705 (N2K86_16705) | 3559493..3560218 | - | 726 | WP_260659335.1 | helix-turn-helix transcriptional regulator | - |
| N2K86_RS16710 (N2K86_16710) | 3560315..3560734 | + | 420 | WP_260659336.1 | nuclear transport factor 2 family protein | - |
| N2K86_RS16715 (N2K86_16715) | 3560742..3561923 | - | 1182 | WP_260659337.1 | PLP-dependent aminotransferase family protein | - |
| N2K86_RS16720 (N2K86_16720) | 3561944..3562831 | - | 888 | WP_260659338.1 | LysR family transcriptional regulator | - |
| N2K86_RS16725 (N2K86_16725) | 3562929..3563531 | + | 603 | WP_260659339.1 | short chain dehydrogenase | - |
| N2K86_RS16730 (N2K86_16730) | 3563525..3564259 | - | 735 | WP_260659340.1 | class I SAM-dependent methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11717.28 Da Isoelectric Point: 9.9488
>T257483 WP_260659333.1 NZ_CP104285:3558815-3559114 [Enterobacter mori]
MINHFRDQWLEDFFLYGRSSNVIPVNLETALARKLDIINSATSHRDLRSPPGNMYEALNPPLKGYSSIRVNRQYRLVFRW
TEGRADDLYLSPHKYTHHK
MINHFRDQWLEDFFLYGRSSNVIPVNLETALARKLDIINSATSHRDLRSPPGNMYEALNPPLKGYSSIRVNRQYRLVFRW
TEGRADDLYLSPHKYTHHK
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|