Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 3441896..3442571 | Replicon | chromosome |
| Accession | NZ_CP104284 | ||
| Organism | Enterobacter hormaechei subsp. steigerwaltii strain JT.WLB1A | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A837FDC1 |
| Locus tag | N2K85_RS16080 | Protein ID | WP_015571638.1 |
| Coordinates | 3441896..3442195 (+) | Length | 100 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | N2K85_RS16085 | Protein ID | WP_260673206.1 |
| Coordinates | 3442206..3442571 (+) | Length | 122 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N2K85_RS16070 (N2K85_16070) | 3438273..3440465 | + | 2193 | WP_039269968.1 | type I secretion system permease/ATPase | - |
| N2K85_RS16075 (N2K85_16075) | 3440446..3441645 | + | 1200 | WP_017382757.1 | HlyD family efflux transporter periplasmic adaptor subunit | - |
| N2K85_RS16080 (N2K85_16080) | 3441896..3442195 | + | 300 | WP_015571638.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| N2K85_RS16085 (N2K85_16085) | 3442206..3442571 | + | 366 | WP_260673206.1 | HigA family addiction module antitoxin | Antitoxin |
| N2K85_RS16090 (N2K85_16090) | 3442598..3443779 | - | 1182 | WP_017382758.1 | PLP-dependent aminotransferase family protein | - |
| N2K85_RS16095 (N2K85_16095) | 3443800..3444687 | - | 888 | WP_015571641.1 | LysR family transcriptional regulator | - |
| N2K85_RS16100 (N2K85_16100) | 3444785..3445387 | + | 603 | WP_015571642.1 | short chain dehydrogenase | - |
| N2K85_RS16105 (N2K85_16105) | 3445381..3446115 | - | 735 | WP_017692800.1 | class I SAM-dependent methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11624.29 Da Isoelectric Point: 9.6776
>T257469 WP_015571638.1 NZ_CP104284:3441896-3442195 [Enterobacter hormaechei subsp. steigerwaltii]
MINHFRDQWLEDFFLYGRSSNVIPLNLETALARKLDIINAAMSHLDLRSPPGNMYEALSPPLKGYSSIRVNRQYRLVFRW
SEGKADDLYLSPHKYTQHK
MINHFRDQWLEDFFLYGRSSNVIPLNLETALARKLDIINAAMSHLDLRSPPGNMYEALSPPLKGYSSIRVNRQYRLVFRW
SEGKADDLYLSPHKYTQHK
Download Length: 300 bp
Antitoxin
Download Length: 122 a.a. Molecular weight: 13647.70 Da Isoelectric Point: 9.9629
>AT257469 WP_260673206.1 NZ_CP104284:3442206-3442571 [Enterobacter hormaechei subsp. steigerwaltii]
MTLQQALRKPTTPGEVLQYEYLAPLNLKINDLAEMLNVHRNTVSALVNNNRKLTADMAIKLAKAFNTTIEFWLNLQLNVD
IWEAQSNSRTQEELSRIKTVAEVMAKRKSGKPDVTLHGNSA
MTLQQALRKPTTPGEVLQYEYLAPLNLKINDLAEMLNVHRNTVSALVNNNRKLTADMAIKLAKAFNTTIEFWLNLQLNVD
IWEAQSNSRTQEELSRIKTVAEVMAKRKSGKPDVTLHGNSA
Download Length: 366 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|