Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 4768643..4769245 | Replicon | chromosome |
| Accession | NZ_CP104274 | ||
| Organism | Escherichia coli strain Ec15103 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | S1P416 |
| Locus tag | N2O69_RS23310 | Protein ID | WP_000897302.1 |
| Coordinates | 4768934..4769245 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | N2O69_RS23305 | Protein ID | WP_000356397.1 |
| Coordinates | 4768643..4768933 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N2O69_RS23280 (4764716) | 4764716..4765618 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
| N2O69_RS23285 (4765615) | 4765615..4766250 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
| N2O69_RS23290 (4766247) | 4766247..4767176 | + | 930 | WP_000027720.1 | formate dehydrogenase accessory protein FdhE | - |
| N2O69_RS23295 (4767392) | 4767392..4767610 | - | 219 | WP_001314326.1 | CopG family transcriptional regulator | - |
| N2O69_RS23300 (4768006) | 4768006..4768284 | - | 279 | WP_001296612.1 | hypothetical protein | - |
| N2O69_RS23305 (4768643) | 4768643..4768933 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
| N2O69_RS23310 (4768934) | 4768934..4769245 | - | 312 | WP_000897302.1 | hypothetical protein | Toxin |
| N2O69_RS23315 (4769474) | 4769474..4770382 | + | 909 | WP_001774092.1 | alpha/beta hydrolase | - |
| N2O69_RS23320 (4770446) | 4770446..4771387 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| N2O69_RS23325 (4771432) | 4771432..4771869 | - | 438 | WP_000560978.1 | D-aminoacyl-tRNA deacylase | - |
| N2O69_RS23330 (4771866) | 4771866..4772738 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
| N2O69_RS23335 (4772732) | 4772732..4773331 | - | 600 | WP_001314324.1 | glucose-1-phosphatase | - |
| N2O69_RS23340 (4773430) | 4773430..4774215 | - | 786 | WP_000059678.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12203.19 Da Isoelectric Point: 9.7791
>T257456 WP_000897302.1 NZ_CP104274:c4769245-4768934 [Escherichia coli]
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|