Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 3771947..3772641 | Replicon | chromosome |
Accession | NZ_CP104274 | ||
Organism | Escherichia coli strain Ec15103 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | S1PJQ2 |
Locus tag | N2O69_RS18540 | Protein ID | WP_001263500.1 |
Coordinates | 3771947..3772345 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | S1QAE3 |
Locus tag | N2O69_RS18545 | Protein ID | WP_000554758.1 |
Coordinates | 3772348..3772641 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N2O69_RS18515 (3767312) | 3767312..3767770 | - | 459 | WP_001291991.1 | xanthine phosphoribosyltransferase | - |
N2O69_RS18520 (3768031) | 3768031..3769488 | + | 1458 | WP_001292999.1 | cytosol nonspecific dipeptidase | - |
N2O69_RS18525 (3769545) | 3769545..3770159 | - | 615 | WP_000602124.1 | peptide chain release factor H | - |
N2O69_RS18530 (3770156) | 3770156..3771295 | - | 1140 | WP_000521561.1 | RNA ligase RtcB family protein | - |
N2O69_RS18535 (3771485) | 3771485..3771937 | - | 453 | WP_001059895.1 | GNAT family N-acetyltransferase | - |
N2O69_RS18540 (3771947) | 3771947..3772345 | - | 399 | WP_001263500.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
N2O69_RS18545 (3772348) | 3772348..3772641 | - | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
N2O69_RS18550 (3772693) | 3772693..3773738 | - | 1046 | Protein_3633 | DNA polymerase IV | - |
N2O69_RS18555 (3773809) | 3773809..3774732 | - | 924 | WP_001532973.1 | putative lateral flagellar export/assembly protein LafU | - |
N2O69_RS18560 (3774735) | 3774735..3775598 | - | 864 | WP_001169518.1 | flagellar motor stator protein MotA | - |
N2O69_RS18565 (3775611) | 3775611..3776327 | - | 717 | WP_000938731.1 | FliA/WhiG family RNA polymerase sigma factor | - |
N2O69_RS18570 (3776347) | 3776347..3776814 | - | 468 | WP_000725261.1 | flagellar basal body-associated FliL family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15413.85 Da Isoelectric Point: 8.9511
>T257446 WP_001263500.1 NZ_CP104274:c3772345-3771947 [Escherichia coli]
MRVFKTKLIRLQLTAEELEALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDAAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELEALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDAAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|