Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
| Location | 3544209..3544888 | Replicon | chromosome |
| Accession | NZ_CP104274 | ||
| Organism | Escherichia coli strain Ec15103 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | S1PK60 |
| Locus tag | N2O69_RS17500 | Protein ID | WP_000057523.1 |
| Coordinates | 3544586..3544888 (-) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | S1QAY3 |
| Locus tag | N2O69_RS17495 | Protein ID | WP_000806442.1 |
| Coordinates | 3544209..3544550 (-) | Length | 114 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N2O69_RS17485 (3540453) | 3540453..3541385 | - | 933 | WP_001538399.1 | glutaminase A | - |
| N2O69_RS17490 (3541647) | 3541647..3544151 | + | 2505 | WP_000083948.1 | copper-exporting P-type ATPase CopA | - |
| N2O69_RS17495 (3544209) | 3544209..3544550 | - | 342 | WP_000806442.1 | HigA family addiction module antitoxin | Antitoxin |
| N2O69_RS17500 (3544586) | 3544586..3544888 | - | 303 | WP_000057523.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| N2O69_RS17505 (3545021) | 3545021..3545815 | + | 795 | WP_001538398.1 | TraB/GumN family protein | - |
| N2O69_RS17510 (3546019) | 3546019..3546498 | + | 480 | WP_001538397.1 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK | - |
| N2O69_RS17515 (3546535) | 3546535..3548187 | - | 1653 | WP_001773867.1 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
| N2O69_RS17520 (3548405) | 3548405..3549625 | + | 1221 | WP_001773866.1 | fosmidomycin MFS transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11809.44 Da Isoelectric Point: 10.3980
>T257444 WP_000057523.1 NZ_CP104274:c3544888-3544586 [Escherichia coli]
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|