Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
| Location | 726763..727456 | Replicon | chromosome |
| Accession | NZ_CP104274 | ||
| Organism | Escherichia coli strain Ec15103 | ||
Toxin (Protein)
| Gene name | mqsR | Uniprot ID | S1EZG2 |
| Locus tag | N2O69_RS03530 | Protein ID | WP_000415584.1 |
| Coordinates | 726763..727059 (+) | Length | 99 a.a. |
Antitoxin (Protein)
| Gene name | mqsA | Uniprot ID | S1EBV2 |
| Locus tag | N2O69_RS03535 | Protein ID | WP_000650107.1 |
| Coordinates | 727061..727456 (+) | Length | 132 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N2O69_RS03495 (721851) | 721851..722165 | - | 315 | WP_000958598.1 | putative quinol monooxygenase | - |
| N2O69_RS03500 (722196) | 722196..722777 | - | 582 | WP_000065430.1 | NADPH:quinone oxidoreductase MdaB | - |
| N2O69_RS03505 (723096) | 723096..723428 | + | 333 | WP_000917685.1 | DUF2645 family protein | - |
| N2O69_RS03510 (723474) | 723474..724823 | - | 1350 | WP_000673402.1 | quorum sensing histidine kinase QseC | - |
| N2O69_RS03515 (724820) | 724820..725479 | - | 660 | WP_001221493.1 | quorum sensing response regulator transcription factor QseB | - |
| N2O69_RS03520 (725631) | 725631..726023 | + | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
| N2O69_RS03525 (726076) | 726076..726558 | + | 483 | WP_000183505.1 | GyrI-like domain-containing protein | - |
| N2O69_RS03530 (726763) | 726763..727059 | + | 297 | WP_000415584.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
| N2O69_RS03535 (727061) | 727061..727456 | + | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
| N2O69_RS03540 (727589) | 727589..729196 | + | 1608 | WP_001295629.1 | ABC transporter substrate-binding protein | - |
| N2O69_RS03545 (729334) | 729334..731592 | + | 2259 | WP_001281841.1 | DNA topoisomerase IV subunit A | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11231.96 Da Isoelectric Point: 8.9070
>T257435 WP_000415584.1 NZ_CP104274:726763-727059 [Escherichia coli]
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT257435 WP_000650107.1 NZ_CP104274:727061-727456 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|