Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 5608912..5609507 | Replicon | chromosome |
Accession | NZ_CP104254 | ||
Organism | Pseudomonas aeruginosa strain PALA1 |
Toxin (Protein)
Gene name | higB | Uniprot ID | V6ALY3 |
Locus tag | PALA1_RS26620 | Protein ID | WP_003113526.1 |
Coordinates | 5609229..5609507 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A0S3KUN4 |
Locus tag | PALA1_RS26615 | Protein ID | WP_003111575.1 |
Coordinates | 5608912..5609217 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PALA1_RS26580 (PALA1_05246) | 5604064..5604912 | + | 849 | WP_009878189.1 | 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase | - |
PALA1_RS26590 (PALA1_05248) | 5605079..5606020 | + | 942 | WP_003099281.1 | ribose-phosphate pyrophosphokinase | - |
PALA1_RS26595 (PALA1_05249) | 5606137..5606751 | + | 615 | WP_003095013.1 | 50S ribosomal protein L25/general stress protein Ctc | - |
PALA1_RS26600 (PALA1_05250) | 5606792..5607376 | + | 585 | WP_003099278.1 | aminoacyl-tRNA hydrolase | - |
PALA1_RS26605 (PALA1_05251) | 5607417..5608517 | + | 1101 | WP_003099270.1 | redox-regulated ATPase YchF | - |
PALA1_RS26615 (PALA1_05253) | 5608912..5609217 | - | 306 | WP_003111575.1 | HigA family addiction module antitoxin | Antitoxin |
PALA1_RS26620 | 5609229..5609507 | - | 279 | WP_003113526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PALA1_RS26625 | 5609560..5609688 | - | 129 | Protein_5262 | integrase | - |
PALA1_RS26630 (PALA1_05254) | 5609836..5612064 | + | 2229 | WP_021264080.1 | TonB-dependent receptor | - |
PALA1_RS26635 (PALA1_05255) | 5612134..5612781 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
PALA1_RS26640 (PALA1_05256) | 5612843..5614081 | - | 1239 | WP_003111578.1 | C69 family dipeptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10646.19 Da Isoelectric Point: 7.8937
>T257432 WP_003113526.1 NZ_CP104254:c5609507-5609229 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V6ALY3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0S3KUN4 |