Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 3318042..3318662 | Replicon | chromosome |
Accession | NZ_CP104215 | ||
Organism | Burkholderia gladioli strain ZN-S4 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A838CB01 |
Locus tag | NYZ96_RS32580 | Protein ID | WP_046574672.1 |
Coordinates | 3318384..3318662 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A560VTG3 |
Locus tag | NYZ96_RS32575 | Protein ID | WP_029951048.1 |
Coordinates | 3318042..3318365 (-) | Length | 108 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NYZ96_RS32555 (NYZ96_32555) | 3313772..3314185 | - | 414 | WP_013690200.1 | MarR family transcriptional regulator | - |
NYZ96_RS32560 (NYZ96_32560) | 3314293..3315480 | - | 1188 | WP_260531665.1 | HPP family protein | - |
NYZ96_RS32565 (NYZ96_32565) | 3315873..3316829 | + | 957 | WP_025100402.1 | LysR family transcriptional regulator | - |
NYZ96_RS32570 (NYZ96_32570) | 3316849..3317934 | - | 1086 | WP_025100403.1 | ionic transporter y4hA | - |
NYZ96_RS32575 (NYZ96_32575) | 3318042..3318365 | - | 324 | WP_029951048.1 | HigA family addiction module antitoxin | Antitoxin |
NYZ96_RS32580 (NYZ96_32580) | 3318384..3318662 | - | 279 | WP_046574672.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NYZ96_RS32585 (NYZ96_32585) | 3318906..3319574 | + | 669 | WP_025100406.1 | MarC family protein | - |
NYZ96_RS32590 (NYZ96_32590) | 3319692..3320561 | - | 870 | WP_126241135.1 | CPBP family intramembrane metalloprotease | - |
NYZ96_RS32595 (NYZ96_32595) | 3320835..3321557 | - | 723 | WP_046574677.1 | fumarylacetoacetate hydrolase family protein | - |
NYZ96_RS32600 (NYZ96_32600) | 3321706..3322806 | - | 1101 | WP_105848813.1 | helix-turn-helix transcriptional regulator | - |
NYZ96_RS32605 (NYZ96_32605) | 3322999..3323601 | - | 603 | WP_013690210.1 | TetR/AcrR family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10401.00 Da Isoelectric Point: 9.9309
>T257423 WP_046574672.1 NZ_CP104215:c3318662-3318384 [Burkholderia gladioli]
MIQSFRCKRTAALFAGESPPAWRAVAQVARRKLAMLDAAQALRDLAVPPGNQLEGLFGDRAGQYSIRINERWRLCFVWSS
RGPELVEIVDYH
MIQSFRCKRTAALFAGESPPAWRAVAQVARRKLAMLDAAQALRDLAVPPGNQLEGLFGDRAGQYSIRINERWRLCFVWSS
RGPELVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A838CB01 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A560VTG3 |