Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4658013..4658615 | Replicon | chromosome |
Accession | NZ_CP104206 | ||
Organism | Escherichia coli strain hubt-sl |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | N1H45_RS22680 | Protein ID | WP_000897305.1 |
Coordinates | 4658304..4658615 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | N1H45_RS22675 | Protein ID | WP_000356397.1 |
Coordinates | 4658013..4658303 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N1H45_RS22650 (4653939) | 4653939..4654841 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
N1H45_RS22655 (4654838) | 4654838..4655473 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
N1H45_RS22660 (4655470) | 4655470..4656399 | + | 930 | WP_000027702.1 | formate dehydrogenase accessory protein FdhE | - |
N1H45_RS22665 (4656729) | 4656729..4656971 | - | 243 | WP_001086388.1 | protein YiiF | - |
N1H45_RS22670 (4657190) | 4657190..4657408 | - | 219 | WP_001295676.1 | CopG family transcriptional regulator | - |
N1H45_RS22675 (4658013) | 4658013..4658303 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
N1H45_RS22680 (4658304) | 4658304..4658615 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
N1H45_RS22685 (4658844) | 4658844..4659752 | + | 909 | WP_001162704.1 | alpha/beta hydrolase | - |
N1H45_RS22690 (4659816) | 4659816..4660757 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
N1H45_RS22695 (4660802) | 4660802..4661239 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
N1H45_RS22700 (4661236) | 4661236..4662108 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
N1H45_RS22705 (4662102) | 4662102..4662701 | - | 600 | WP_001315111.1 | glucose-1-phosphatase | - |
N1H45_RS22710 (4662800) | 4662800..4663585 | - | 786 | WP_000059678.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T257415 WP_000897305.1 NZ_CP104206:c4658615-4658304 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|