Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ralRA/- |
| Location | 2156218..2156589 | Replicon | chromosome |
| Accession | NZ_CP104206 | ||
| Organism | Escherichia coli strain hubt-sl | ||
Toxin (Protein)
| Gene name | ralR | Uniprot ID | F4VC37 |
| Locus tag | N1H45_RS10475 | Protein ID | WP_001317028.1 |
| Coordinates | 2156395..2156589 (-) | Length | 65 a.a. |
Antitoxin (RNA)
| Gene name | ralA | ||
| Locus tag | - | ||
| Coordinates | 2156218..2156396 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N1H45_RS10450 (2152173) | 2152173..2153546 | + | 1374 | WP_000123740.1 | ATP-dependent RNA helicase DbpA | - |
| N1H45_RS10455 (2153675) | 2153675..2154610 | - | 936 | WP_001157422.1 | tRNA 2-thiocytidine(32) synthetase TtcA | - |
| N1H45_RS10460 (2154662) | 2154662..2155897 | - | 1236 | WP_000040852.1 | site-specific integrase | - |
| N1H45_RS10465 (2155899) | 2155899..2156114 | - | 216 | WP_000079604.1 | excisionase XisR | - |
| - (2156218) | 2156218..2156396 | + | 179 | NuclAT_0 | - | Antitoxin |
| - (2156218) | 2156218..2156396 | + | 179 | NuclAT_0 | - | Antitoxin |
| - (2156218) | 2156218..2156396 | + | 179 | NuclAT_0 | - | Antitoxin |
| - (2156218) | 2156218..2156396 | + | 179 | NuclAT_0 | - | Antitoxin |
| N1H45_RS10470 (2156193) | 2156193..2156402 | - | 210 | WP_000276809.1 | double-strand break reduction protein RcbA | - |
| N1H45_RS10475 (2156395) | 2156395..2156589 | - | 195 | WP_001317028.1 | type I toxin-antitoxin system endodeoxyribonuclease toxin RalR | Toxin |
| N1H45_RS10480 (2156646) | 2156646..2157455 | - | 810 | WP_000166319.1 | recombination protein RecT | - |
| N1H45_RS10485 (2157448) | 2157448..2160048 | - | 2601 | WP_000105152.1 | exodeoxyribonuclease VIII | - |
| N1H45_RS10490 (2160150) | 2160150..2160425 | - | 276 | WP_001349884.1 | hypothetical protein | - |
| N1H45_RS10495 (2160500) | 2160500..2160670 | - | 171 | WP_001349883.1 | YdaE family protein | - |
| N1H45_RS10500 (2160670) | 2160670..2160891 | - | 222 | WP_000560220.1 | killing protein KilR | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2154662..2204856 | 50194 | |
| - | flank | IS/Tn | - | - | 2161047..2162255 | 1208 | |
| - | inside | Prophage | - | - | 2123138..2204856 | 81718 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 65 a.a. Molecular weight: 7018.89 Da Isoelectric Point: 8.9538
>T257398 WP_001317028.1 NZ_CP104206:c2156589-2156395 [Escherichia coli]
MRYDNVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
MRYDNVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
Download Length: 195 bp
Antitoxin
Download Length: 179 bp
>AT257398 NZ_CP104206:2156218-2156396 [Escherichia coli]
GAGGACTGAAGTTTCTCGCAATTAAAATTTATCAATTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTACCTGA
GAGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTT
CAATAGTGGCGGTAATTTT
GAGGACTGAAGTTTCTCGCAATTAAAATTTATCAATTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTACCTGA
GAGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTT
CAATAGTGGCGGTAATTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
