Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 31140..31783 Replicon plasmid pCHN23026_2
Accession NZ_CP104198
Organism Klebsiella pneumoniae strain CHN23026

Toxin (Protein)


Gene name vagD Uniprot ID Q84A06
Locus tag N3931_RS27145 Protein ID WP_000754566.1
Coordinates 31140..31556 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q84A07
Locus tag N3931_RS27150 Protein ID WP_001261276.1
Coordinates 31553..31783 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N3931_RS27120 (N3931_27120) 26542..27246 - 705 WP_001067855.1 IS6-like element IS26 family transposase -
N3931_RS27125 (N3931_27125) 27314..27835 + 522 Protein_34 transposase -
N3931_RS27130 (N3931_27130) 27998..28081 - 84 Protein_35 SOS response-associated peptidase -
N3931_RS27135 (N3931_27135) 28722..29798 - 1077 WP_000227969.1 IS110 family transposase -
N3931_RS27140 (N3931_27140) 30080..30936 - 857 Protein_37 IS3-like element ISEc15 family transposase -
N3931_RS27145 (N3931_27145) 31140..31556 - 417 WP_000754566.1 type II toxin-antitoxin system VapC family toxin Toxin
N3931_RS27150 (N3931_27150) 31553..31783 - 231 WP_001261276.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
N3931_RS27155 (N3931_27155) 32357..32707 + 351 WP_000493378.1 hypothetical protein -
N3931_RS27160 (N3931_27160) 32758..33501 + 744 WP_000129823.1 hypothetical protein -
N3931_RS27165 (N3931_27165) 33498..34274 + 777 WP_000015958.1 site-specific integrase -
N3931_RS27170 (N3931_27170) 34332..34589 - 258 WP_000764642.1 hypothetical protein -
N3931_RS27175 (N3931_27175) 34718..34822 - 105 WP_032409716.1 hypothetical protein -
N3931_RS27180 (N3931_27180) 35352..36218 + 867 WP_260578096.1 replication initiation protein -
N3931_RS27185 (N3931_27185) 36395..36664 - 270 WP_000339857.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Mobilizable plasmid qnrB4 / blaDHA-1 / sul1 / mph(A) / aph(3')-Ia / aac(6')-Ib-cr / blaOXA-1 / catB3 / ARR-3 / qacE - 1..57644 57644


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15006.52 Da        Isoelectric Point: 9.2957

>T257387 WP_000754566.1 NZ_CP104198:c31556-31140 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAVLPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNVREFARVPGLVLEDWVK

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8721.74 Da        Isoelectric Point: 4.3533

>AT257387 WP_001261276.1 NZ_CP104198:c31783-31553 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRADPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A387K1G3

Antitoxin

Source ID Structure
AlphaFold DB A0A387K023

References