Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 741239..742014 | Replicon | chromosome |
| Accession | NZ_CP104196 | ||
| Organism | Klebsiella pneumoniae strain CHN23026 | ||
Toxin (Protein)
| Gene name | TacT2 | Uniprot ID | A0A1Q4Q548 |
| Locus tag | N3931_RS03720 | Protein ID | WP_004150910.1 |
| Coordinates | 741529..742014 (+) | Length | 162 a.a. |
Antitoxin (Protein)
| Gene name | TacA2 | Uniprot ID | W8UEW1 |
| Locus tag | N3931_RS03715 | Protein ID | WP_004150912.1 |
| Coordinates | 741239..741532 (+) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N3931_RS03695 (N3931_03695) | 736447..737049 | - | 603 | WP_002916735.1 | short chain dehydrogenase | - |
| N3931_RS03700 (N3931_03700) | 737147..738058 | + | 912 | WP_004188550.1 | LysR family transcriptional regulator | - |
| N3931_RS03705 (N3931_03705) | 738059..739207 | - | 1149 | WP_004150915.1 | PLP-dependent aspartate aminotransferase family protein | - |
| N3931_RS03710 (N3931_03710) | 739218..740594 | - | 1377 | WP_004217775.1 | cystathionine beta-synthase | - |
| N3931_RS03715 (N3931_03715) | 741239..741532 | + | 294 | WP_004150912.1 | DUF1778 domain-containing protein | Antitoxin |
| N3931_RS03720 (N3931_03720) | 741529..742014 | + | 486 | WP_004150910.1 | GNAT family N-acetyltransferase | Toxin |
| N3931_RS03725 (N3931_03725) | 742718..743311 | + | 594 | WP_004188553.1 | hypothetical protein | - |
| N3931_RS03730 (N3931_03730) | 743408..743624 | + | 217 | Protein_733 | transposase | - |
| N3931_RS03735 (N3931_03735) | 744230..745102 | + | 873 | WP_004188557.1 | ParA family protein | - |
| N3931_RS03740 (N3931_03740) | 745102..745485 | + | 384 | WP_004150906.1 | hypothetical protein | - |
| N3931_RS03745 (N3931_03745) | 745478..746845 | + | 1368 | WP_004150905.1 | SPI-7-type island replicative DNA helicase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| flank | IS/Tn | - | - | 743408..743560 | 152 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17551.59 Da Isoelectric Point: 8.8818
>T257374 WP_004150910.1 NZ_CP104196:741529-742014 [Klebsiella pneumoniae]
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPAPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPAPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1Q4Q548 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GVL4 |