Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
Location | 4871382..4871977 | Replicon | chromosome |
Accession | NZ_CP104170 | ||
Organism | Pseudomonas aeruginosa strain HW001G |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A241XLJ5 |
Locus tag | NDR95_RS22860 | Protein ID | WP_003117425.1 |
Coordinates | 4871699..4871977 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NDR95_RS22855 | Protein ID | WP_003099268.1 |
Coordinates | 4871382..4871687 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NDR95_RS22820 (NDR95_22820) | 4866523..4867371 | + | 849 | WP_003117426.1 | 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase | - |
NDR95_RS22830 (NDR95_22830) | 4867538..4868479 | + | 942 | WP_003099281.1 | ribose-phosphate pyrophosphokinase | - |
NDR95_RS22835 (NDR95_22835) | 4868596..4869210 | + | 615 | WP_003099279.1 | 50S ribosomal protein L25/general stress protein Ctc | - |
NDR95_RS22840 (NDR95_22840) | 4869252..4869836 | + | 585 | WP_003099278.1 | aminoacyl-tRNA hydrolase | - |
NDR95_RS22845 (NDR95_22845) | 4869877..4870977 | + | 1101 | WP_003099270.1 | redox-regulated ATPase YchF | - |
NDR95_RS22855 (NDR95_22855) | 4871382..4871687 | - | 306 | WP_003099268.1 | HigA family addiction module antitoxin | Antitoxin |
NDR95_RS22860 (NDR95_22860) | 4871699..4871977 | - | 279 | WP_003117425.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NDR95_RS22865 (NDR95_22865) | 4872030..4872158 | - | 129 | Protein_4511 | integrase | - |
NDR95_RS22870 (NDR95_22870) | 4872306..4874534 | + | 2229 | WP_119565521.1 | TonB-dependent receptor | - |
NDR95_RS22875 (NDR95_22875) | 4874604..4875251 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
NDR95_RS22880 (NDR95_22880) | 4875313..4876551 | - | 1239 | WP_014603324.1 | C69 family dipeptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10701.28 Da Isoelectric Point: 8.5576
>T257364 WP_003117425.1 NZ_CP104170:c4871977-4871699 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|