Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 4164280..4164961 | Replicon | chromosome |
Accession | NZ_CP104170 | ||
Organism | Pseudomonas aeruginosa strain HW001G |
Toxin (Protein)
Gene name | higB | Uniprot ID | V6AKP0 |
Locus tag | NDR95_RS19550 | Protein ID | WP_003111825.1 |
Coordinates | 4164596..4164961 (-) | Length | 122 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NDR95_RS19545 | Protein ID | WP_023112790.1 |
Coordinates | 4164280..4164603 (-) | Length | 108 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NDR95_RS19525 (NDR95_19525) | 4159733..4161406 | + | 1674 | WP_128652968.1 | hypothetical protein | - |
NDR95_RS19530 (NDR95_19530) | 4161403..4162110 | + | 708 | WP_119565573.1 | DUF3800 domain-containing protein | - |
NDR95_RS19535 (NDR95_19535) | 4162107..4162592 | + | 486 | WP_058160013.1 | hypothetical protein | - |
NDR95_RS19545 (NDR95_19545) | 4164280..4164603 | - | 324 | WP_023112790.1 | XRE family transcriptional regulator | Antitoxin |
NDR95_RS19550 (NDR95_19550) | 4164596..4164961 | - | 366 | WP_003111825.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NDR95_RS19555 (NDR95_19555) | 4165253..4165427 | - | 175 | Protein_3864 | hypothetical protein | - |
NDR95_RS19560 (NDR95_19560) | 4165634..4165906 | + | 273 | WP_031805311.1 | hypothetical protein | - |
NDR95_RS19565 (NDR95_19565) | 4165937..4166362 | - | 426 | WP_003140891.1 | VOC family protein | - |
NDR95_RS19570 (NDR95_19570) | 4166463..4167347 | + | 885 | WP_031805310.1 | LysR substrate-binding domain-containing protein | - |
NDR95_RS19575 (NDR95_19575) | 4167320..4168273 | - | 954 | WP_003085661.1 | LysR substrate-binding domain-containing protein | - |
NDR95_RS19580 (NDR95_19580) | 4168494..4168928 | + | 435 | WP_003158601.1 | RidA family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 4149769..4167347 | 17578 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 122 a.a. Molecular weight: 13880.24 Da Isoelectric Point: 4.8219
>T257362 WP_003111825.1 NZ_CP104170:c4164961-4164596 [Pseudomonas aeruginosa]
VAWDIEYTDEFGDWWGSLSEDEQESLAVTVRLLEERGPSLGHPHSSGINGSRHGHMRELRTQHGGRPFRTLYAFDPRRSA
ILLIGGDKTGDDRWYELNVPIADRLYDEHLHQLREEGLIDG
VAWDIEYTDEFGDWWGSLSEDEQESLAVTVRLLEERGPSLGHPHSSGINGSRHGHMRELRTQHGGRPFRTLYAFDPRRSA
ILLIGGDKTGDDRWYELNVPIADRLYDEHLHQLREEGLIDG
Download Length: 366 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|